KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3860Help
Entry
Mesci_3860        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2161
Motif
Other DBs
NCBI-GeneID: 10119347
NCBI-ProteinID: YP_004143026
UniProt: E8T8S8
Position
3993724..3994422
Genome map
AA seq 232 aa AA seqDB search
MNETSLYAPVKRFLESLDFVVKGEIDGCDVVALREGEPPVVVICELKLQFNLELVLQGVD
RAAACDEVWLAARMSARGKGRESDARFRNLCRRLGFGLLGVTATDRVEVLLSPIALAPRK
NARRRSRLVDEHQRRRGDPVAGGGSRNPIMTAYRQSALACAAAMVDGPRRLRDLKAVTPI
APKILQHNVYGWFARVDRGLYDLTDAGRASLVRWPQASHDESRHAILNAAAI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacctcactctatgcgccggtgaagcggttcctcgaaagcctcgactttgtc
gtcaaaggcgagatcgacggctgcgatgttgttgcgttgcgcgagggggagccgccggtt
gtcgtcatctgcgagttgaagctgcagttcaatctcgaactggtgctgcaaggtgtcgat
cgtgcggcggcctgcgacgaggtgtggctggccgcgcgcatgtcggctcgcggcaaggga
cgcgaaagcgatgccaggttccgcaatctctgccgccggcttggcttcggcttgcttggc
gtgaccgcgacggaccgggtcgaggtgcttctcagcccgatcgcgctggcgccgcgcaag
aatgcccgccggcgctcccgcctggtcgacgagcaccagcgccgtcgcggcgatcccgtt
gccggaggaggatcgcgcaatccgatcatgaccgcctatcgccaaagcgccctcgcctgc
gctgccgccatggtggatggccccaggcggctgcgagatctgaaggcggtgacgccgatc
gcgcccaagatcctgcagcacaatgtctatggctggttcgcgcgcgtcgaccgcggcctg
tacgatcttaccgatgccggccgtgcctctttggtccgttggccgcaggcatcgcacgac
gaatcccgacacgcaattttgaacgcagcagccatatga

DBGET integrated database retrieval system