KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3861Help
Entry
Mesci_3861        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF930
Motif
Other DBs
NCBI-GeneID: 10119348
NCBI-ProteinID: YP_004143027
UniProt: E8T8S9
Position
3994512..3994886
Genome map
AA seq 124 aa AA seqDB search
MTALASVTLSFPASAMDNALRAGLMKLDPQTRLEQRCDAEVLDRITHDDRKFKADRVVAY
AFATPEMGADAIKSPGAAFRSKGQWYRLKFKCQTGPDHMEVLQLRYRIGDEIPEADWAKY
NLYD
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccttggcgtcagtgacactgagttttccagccagcgcaatggacaatgcattg
cgcgccggactgatgaaactcgatccccaaactcgccttgaacagcgttgcgacgccgaa
gtgctcgaccgcatcacccatgacgatcgcaagttcaaagccgatcgcgtcgtcgcctac
gcctttgccacgcccgagatgggcgccgatgccatcaagagcccgggtgctgcgtttcgc
agcaaggggcagtggtataggctgaaattcaagtgccagaccgggccggaccatatggaa
gtcttgcaactccgctaccggatcggcgacgagattccggaagccgactgggcaaagtat
aatctctacgattga

DBGET integrated database retrieval system