KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3862Help
Entry
Mesci_3862        CDS       T01401                                 

Definition
(RefSeq) integral membrane protein TerC
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerC Polysacc_synt_3 TarH TMEM100
Motif
Other DBs
NCBI-GeneID: 10119349
NCBI-ProteinID: YP_004143028
UniProt: E8T8T0
Position
3995068..3995730
Genome map
AA seq 220 aa AA seqDB search
MDIFFSAASLTALLQVIAIDLVLAGDNAIVIGLAAAGLPADQRKKAILIGVIAATVLRIG
FAAITVKLLAIVGLLLAGGILLLWVCWKMYRELRTSHADELEATEALSNSDLNSDQAVAG
KSKRKTLGQAALQIVVADVSMSLDNVLAVAGAARDHFPVLVIGLVLSIALMGLAATFIAK
LLHRHRWIAYVGLLIILYVALDMVYRGAVEVWPHVNNVVG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggacatttttttcagcgctgccagcctgaccgccctgctccaggtcatcgccatcgac
ctcgtgctggccggcgacaatgcgatcgtcatcggccttgccgctgccggcctgccggct
gaccaacgcaagaaggcgatcctcatcggcgtgattgcggcaacggtgctgcgcatcggt
tttgccgcaattaccgtcaagctgctggcgatcgtcggcctgctgctggccggcggcatc
ctgctgctgtgggtctgctggaaaatgtaccgcgagctgcgcacgtcacatgccgatgag
ctggaagcgaccgaggcgctgtcgaattcggacctcaacagtgaccaggcagtcgccggc
aagtcgaagcgcaagacccttggccaggctgccttgcagattgtcgtcgccgatgtgtcg
atgtcgctcgacaacgtgctggcggtggctggagcggcgcgtgatcattttccggtgctg
gtcatcggccttgtgctgtcgatcgcgctcatggggctggctgcgaccttcattgccaag
ctgctgcatcgccaccgctggatcgcctatgtcggcctgctgatcatactctatgtcgcg
ctggacatggtctatcgtggcgcggtggaggtctggccacatgtgaacaacgtggtcggc
tga

DBGET integrated database retrieval system