KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3870Help
Entry
Mesci_3870        CDS       T01401                                 

Definition
(RefSeq) phosphatidylcholine synthase
  KO
K01004  phosphatidylcholine synthase [EC:2.7.8.24]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00564  Glycerophospholipid metabolism
mci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mesci_3870
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.24  phosphatidylcholine synthase
     Mesci_3870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-GeneID: 10119357
NCBI-ProteinID: YP_004143036
UniProt: E8T8T8
Position
complement(4004354..4005187)
Genome map
AA seq 277 aa AA seqDB search
MSKNTTARNLAARKAAKKITDRIPRPKKKVTWPQARAFSVHLLTASGSFLAFLSLVAASE
ERWTAMFWWLGLALFVDGIDGPIARKLEVKEILPTWSGELLDNIIDYVTYVLIPAFALYQ
RGFMGEGLSFLSAAIIVVSSAIYYADTGMKTKENFFKGFPVVWNMVVFTLFVIEPGQWVS
FAVVVVAGVLTFVPINFIHPVRVVRLRRINLGMTLLWCAFGALALAQAALAAFYDQIGVL
GEQVSTFTKIGITITGLYLACIGGIMQFFPNLGAKKA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagaacacaacggccaggaatttggcagcacgaaaagccgccaaaaagatcacg
gaccggattccgcgcccgaagaagaaggtcacctggccgcaggcgagggcgttctccgtc
caccttttgaccgcctcggggtcgttcctggccttcctgtcgctcgtggcggcaagtgaa
gagcgctggaccgcaatgttctggtggctcgggctggccctgttcgtcgacggcatcgat
gggccgatcgccagaaaactcgaggtcaaggagatcctgccgacatggtcgggcgaactg
ctcgacaacatcatcgactacgtgacctacgtgctgatcccggccttcgcgctctatcag
cgcggcttcatgggcgagggcctgtcattcctgtcggcggcgatcatcgtcgtttccagc
gccatctactatgccgacaccggcatgaagacgaaggagaatttcttcaagggattcccg
gtggtctggaacatggtggtgttcaccctgttcgtcatcgagcccggacaatgggtttcg
ttcgcggtggtggtggtggccggcgtcctgactttcgtgccgatcaacttcatccacccg
gtgcgggtggtgcggctgcggcgcatcaaccttgggatgaccctgttgtggtgcgctttc
ggcgcgcttgccctggcccaagcggcgctcgccgccttctacgatcagatcggcgtgctg
ggcgagcaggtcagcaccttcaccaagatcggcatcaccatcaccgggctttatcttgcc
tgcatcggtggcatcatgcagttctttcccaatctcggtgccaaaaaggcctga

DBGET integrated database retrieval system