KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3871Help
Entry
Mesci_3871        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1326
Motif
Other DBs
NCBI-GeneID: 10119358
NCBI-ProteinID: YP_004143037
UniProt: E8T8T9
Position
complement(4005184..4005798)
Genome map
AA seq 204 aa AA seqDB search
MADQSWAMKGELVLSCNCTVFCPCVLSLGNHPPTEGYCQTWAGFRIDAGHFGEVDLSGLN
LGLIMEIPGYMSRGNWTAGLFIDSRASVYAVKALTKIFTGKAGGTTSLLSILVGKFLGVE
QVPITYETRDKTRIFQIPRIIDGAVTPIQGKDRDKDTVISNSEYWIAPEIIVARSDKSKM
RAFGRNWNFAGRSAEICKLDWRGP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccagagctgggcgatgaagggagagctcgtactctcctgcaattgcacggtt
ttttgcccttgcgtgctctcgcttggcaatcatccgccgaccgaaggctattgccagaca
tgggccgggtttcgcatcgatgccggccatttcggtgaggtcgatctgtccgggctcaat
cttgggctgatcatggaaatcccaggctatatgagccgcggcaactggaccgcgggcctg
ttcatcgacagccgcgcctctgtctatgcggtcaaggcgctgacaaagatcttcacgggc
aaggcaggtggaaccacatcgctgctctcaatcctcgtcggcaaattcctcggtgtcgag
caggtgccgatcacctatgagacgcgtgacaaaacgcgtatcttccagatacccaggatt
atcgacggagcggtcacacccatccaaggcaaggaccgtgacaaggatacggtgatcagc
aattcggaatactggatcgcgcccgagatcatcgtggccaggtccgacaagagcaagatg
cgggcttttggccgcaattggaatttcgccggccgttcggccgaaatctgcaagctggat
tggcggggcccgtga

DBGET integrated database retrieval system