KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3874Help
Entry
Mesci_3874        CDS       T01401                                 

Definition
(RefSeq) auxin efflux carrier
  KO
K07088  uncharacterized protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Brite
KEGG Orthology (KO) [BR:mci00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mesci_3874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mem_trans BacteriocIIc_cy
Motif
Other DBs
NCBI-GeneID: 10119361
NCBI-ProteinID: YP_004143040
UniProt: E8T8U2
Position
complement(4008010..4008972)
Genome map
AA seq 320 aa AA seqDB search
MSDVIGLVLPFFGLIFVGFLVARITRQPLEALGWMNTFIVYVALPALFFQLLAKTPFEDL
TEWRFIFGSVVSTFMIFSLMFMGSVLTSRGEIAQSTIKALAAAYGNIGYMGPGLALLAFG
EEAAVPVALIFCFENIMHFAIAPMMMALSGDEKTTPLRLALGVVRKIVLHPFIIATALGV
GAAYIGFRPPVPVERFLEYLSRAAAPCALFAMGVTLALRPLNRVPHEMVPIAALKLILHP
LLCYVVLSWIGNFSETWVFSAVLLAALPTATNVFVIAQQYGVWVQRASASVLITTCLSVV
TVTGLLYLIRHNILAPDLFP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgtcatcggtcttgttcttccgttcttcggcttgatttttgtcgggtttctg
gtggcgcgcatcaccaggcagccgctggaggcgctcggctggatgaacacgttcatcgtc
tatgtcgcgctgccggcacttttcttccaactgcttgccaagacgccgttcgaagacctg
acggaatggcgcttcatcttcggctcggtcgtctcgaccttcatgatattttccttgatg
ttcatggggtcggtcctgacctcgcgcggcgagatagcgcaatcgacaatcaaggcgctc
gcggccgcctatggcaatatcggctatatgggaccgggcctggcattgctggccttcggc
gaggaggcggctgtgccggtcgccttgatcttctgtttcgagaacatcatgcatttcgcc
atcgcgcccatgatgatggcgctgtcgggcgacgagaagaccactcctctccggcttgcg
ctgggtgtggtgcgcaagatcgtgctgcacccgttcatcatcgcaaccgccctgggtgtc
ggcgccgcctatatcggctttcgaccgcccgtgccggtggagcgatttctagaatatctt
tcccgtgcggccgcaccttgcgcgctgtttgccatgggcgtcacgctggcgctcaggcca
ctcaatcgcgtcccgcatgagatggttccgatcgcggcgctgaagttgatcctgcacccg
ttgctctgttatgtcgtgctgagctggatcggcaatttctctgagacatgggtcttctcg
gcggtgcttctggccgcattgccgaccgccacgaacgtcttcgtcatcgcccagcagtat
ggcgtctgggtacagcgagcgtcggccagtgtgctgatcacaacctgcctgtcggtcgtg
accgttaccgggctgctctacctgatccggcacaatatcctagcgccggacctgtttccc
taa

DBGET integrated database retrieval system