KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3875Help
Entry
Mesci_3875        CDS       T01401                                 

Definition
(RefSeq) hemimethylated DNA binding protein
  KO
K11940  heat shock protein HspQ
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Brite
KEGG Orthology (KO) [BR:mci00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mci03036]
    Mesci_3875
Chromosome and associated proteins [BR:mci03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Mesci_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YccV-like
Motif
Other DBs
NCBI-GeneID: 10119362
NCBI-ProteinID: YP_004143041
UniProt: E8T8U3
Position
4009086..4009421
Genome map
AA seq 111 aa AA seqDB search
MVSTMKTAKFAIGQVVRHRLFPFRGIIFDVDPQFANTDEWYEAIPADVRPRKDQPFYHLL
AENSETEYIAYVSEQNLLEDQSGEPVRHPQIKEMFDKRPDGGYQPKRQSTH
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagtacgatgaaaacagccaaattcgcaatcggacaggtggttcgccaccggctg
tttccattcaggggcatcattttcgatgtcgatccgcaattcgccaacaccgacgaatgg
tacgaagccatccccgccgacgtgcggccgcgcaaggatcagcctttctatcatctgctc
gccgagaattcggagaccgaatacatcgcctacgtctccgagcagaatctgcttgaggat
cagtcgggcgagccggtccggcatccgcagatcaaagagatgttcgacaagaggccggac
ggcggctaccagccgaaacggcagtccacgcattag

DBGET integrated database retrieval system