KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3876Help
Entry
Mesci_3876        CDS       T01401                                 

Definition
(RefSeq) invasion associated locus B family protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IalB
Motif
Other DBs
NCBI-GeneID: 10119363
NCBI-ProteinID: YP_004143042
UniProt: E8T8U4
Position
complement(4009495..4010124)
Genome map
AA seq 209 aa AA seqDB search
MTSLNSNAYRLSVMAAGVVGFLGAGLPAASAQQQQQIPQGWFKACTKQEDVDICNVQNIT
TAGNGQLVTGVSLIELKGKVNRKVFQVTVPTGRLVPPGIGLQIDTGKAQKLDYVICFPDR
CVAEVPLTDQLVAAFKKGQAITLTSVNFQNQPNPIKIALQGFSGAYDGPALQQSDIEDRQ
KKLQDFVAKNNQDFAKKLKEEQDKAKTAN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcctgaacagcaacgcgtaccgcctgtcggtcatggccgctggcgtggtcggc
tttctcggcgcagggcttcccgccgcttccgcacagcagcagcagcagattccgcaaggc
tggttcaaggcctgcaccaagcaggaagacgtcgacatctgcaacgtccagaacatcacc
actgccggcaatggccagctggtcaccggcgtcagcctgatcgagctcaagggcaaggtg
aaccgcaaggtgttccaggtgacggttccgaccggccgtctggtgcctcccggcatcggc
ctgcagatcgacaccggcaaggcgcagaagctcgactatgtgatctgcttcccggatcgt
tgcgtggccgaagtgccgctgaccgatcagctcgtcgcggcattcaagaaaggccaggcg
atcacgctgacttccgtcaatttccagaaccagcccaatccgatcaagatcgccctgcag
ggcttcagcggcgcctatgacggcccggcgctgcagcagtcggacatcgaggacaggcag
aagaagcttcaggacttcgtcgccaagaacaaccaggatttcgccaagaagctcaaggaa
gagcaggacaaggcgaagaccgccaactga

DBGET integrated database retrieval system