KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3878Help
Entry
Mesci_3878        CDS       T01401                                 

Definition
(RefSeq) DSBA oxidoreductase
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DSBA Thioredoxin_5 Thioredoxin_3 Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 10119365
NCBI-ProteinID: YP_004143044
UniProt: E8T8U6
Position
4012223..4012903
Genome map
AA seq 226 aa AA seqDB search
MSELNAITVDVVSDVVCPWCFIGQKRLDRAIAAVGDVDVHVRWRPFQLDPTIPPEGKDRR
EYMLAKFGSDERIREIHDRIEPLGEAEDISFAFDAIKVAPNTLDAHRLIRWAGAAGEAIQ
NRLVRRLFQLNFEEGANIGDHAVLVEAAREAGMDASVVASLLPTEADVEAVRTEIATASR
MGISGVPCFLLEDKYAVMGAQDADTLADAIRQVAAAKARGELDKAG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaattgaacgccatcaccgtcgatgtggtgtccgatgtcgtctgcccctggtgc
ttcatcggccagaagcggctcgacagggcaatcgccgccgtcggcgatgtcgacgtgcat
gtccgctggcggccgttccagctcgatccgaccattccgcctgaaggcaaggaccggcgc
gaatacatgctggcaaaattcggcagcgacgagcgtatccgcgagattcacgaccgcatc
gagccgctgggcgaagcggaagacatttcctttgccttcgacgccatcaaagtggcgccg
aatacgctggatgcgcaccggctgatccgctgggcaggggccgccggcgaagccattcag
aacaggcttgtacggcggctgttccagctgaatttcgaggaaggcgccaacattggcgat
catgccgtgctggtcgaggcggcgcgcgaggccggcatggatgcgtccgtggtcgcctcg
cttttgccgaccgaggccgatgtcgaggcggtgcgcaccgagatcgccaccgcgtcgcgc
atgggcatttctggcgtgccgtgcttcctgctcgaggacaaatacgccgtcatgggcgcg
caggatgccgatacgctggccgatgccattcgccaggtggcggccgccaaggcgcgcggc
gaactggacaaggccggctga

DBGET integrated database retrieval system