KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3879Help
Entry
Mesci_3879        CDS       T01401                                 

Definition
(RefSeq) hypothetical protein
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 10119366
NCBI-ProteinID: YP_004143045
UniProt: E8T8U7
Position
complement(4012942..4013370)
Genome map
AA seq 142 aa AA seqDB search
MLARTAAILSLFAFVPLAHAGEQSIPASAEGQIELNTPSGNIGCIYTPKGGTGTYKPRDG
GPELSCSRVEPSYLTIILGPKGPATLIKNPGEQGCCSDVNKLGYGNSWSAGPFSCQSSTK
GLTCTATNGHGFFISKAKATAK
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcacgcacggccgcaatcctgtccctctttgcctttgtacctttggcgcatgcc
ggcgagcaaagcattccggccagcgccgagggccagatcgagttaaacacgccgtccggc
aacatcggctgcatctacacgcccaaaggcggcaccggcacctataagccgagggatggc
ggcccggagctgagctgctcgcgcgtcgagccgagctaccttacgattatcctgggtccg
aaggggccagcaacgctgatcaagaacccaggcgagcagggctgctgcagcgatgtcaac
aagcttggctacggcaacagctggagcgccgggccgttctcgtgccagtcgtcaaccaag
ggactgacctgcacggccacgaacggccatggatttttcatcagcaaggccaaggcgacg
gcgaagtaa

DBGET integrated database retrieval system