KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_3881Help
Entry
Mesci_3881        CDS       T01401                                 

Definition
(RefSeq) magnesium transporter
  KO
K06213  magnesium transporter
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Brite
KEGG Orthology (KO) [BR:mci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mci02000]
    Mesci_3881
Transporters [BR:mci02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mesci_3881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgtE MgtE_N CBS GAF
Motif
Other DBs
NCBI-GeneID: 10119368
NCBI-ProteinID: YP_004143047
UniProt: E8T8U9
Position
4016150..4017514
Genome map
AA seq 454 aa AA seqDB search
MNEFTTVASDEAVAIARILANDHVGDIVEALNREPRETATELLCEVTFERLVEIFDQPEL
DGASELMEALPRAKAGKLLTAMSVDRAADILRELDEPARSELLGGLAPPLRATLLSILGY
PEGSAASIMTTEFVSVPSDWSVGQTLDYIRKVERTRETVYAIYIVDPQTHLLVRSTGLRR
LITGEPDDSIMTVAPDHLPVTVGPLTDRETLAQTISKYDLLAVPVVDHGKILGIVTIDDI
IDTMIAETTEDVHRFGGMEALDEPYMKMSFLAMIRKRGGWLCALFISEMLTANAMQSYEG
ELEKAIVLTLFIPLIMSSGGNSGSQATSLVIRALALREIGLGDWWRVALRELPTGLVLGA
MLGVVGVCRIALWQYMGFYDYGPHWPLIATTVGAALVGIVTFGSLSGSMLPFALKRIGFD
PASASAPFVATLVDVTGLVIYFSVALVILRGTLL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatttaccacggtggcaagcgacgaggccgtcgcgattgcccgtatcctagcc
aacgatcacgtcggcgacattgtcgaggccctgaacagggagcctcgagagaccgcgacg
gaactgctctgtgaagtgacgttcgaacgtctggtcgagatcttcgatcagccggaactc
gacggcgcgtcggaactcatggaggcgctgccgcgcgccaaggcgggcaagctgctcacc
gccatgtcggtcgaccgggcagccgacattctgcgcgagctcgacgagccggcgcgttcc
gagctgctcggcggacttgcgccgccgctgcgcgcaacgctgctctccatcctcggctat
cccgaaggcagtgccgcatcgatcatgacgacggagttcgtcagcgtgccctcggactgg
agcgtcgggcaaacgctcgactacatccgcaaggtggagcggacgcgcgagaccgtctat
gcgatctatatcgtcgatccgcaaacgcacctgcttgtgcgctcgacgggcctgcgccgg
ctgatcaccggtgagccggacgattcgatcatgacggtggcgccggatcatcttccggtg
acggtcggcccgctgaccgatcgcgaaacgctggcgcagacgatctccaaatacgatctg
ctcgcggttccggtcgtcgaccatggcaagatcctcggcatcgtcaccatcgacgacatc
atcgacacgatgatcgcggagacgaccgaggatgtgcaccgtttcggcggcatggaggcg
ctggacgagccgtacatgaagatgagcttcctcgccatgatcaggaaacgcggcggctgg
ctgtgcgcgctgttcatctcggagatgctgacggccaacgccatgcagagctatgagggc
gagctggagaaggcgatcgtgctgacgctgttcatcccgctgatcatgagctccggcggc
aattccggctcgcaggcgacctcgctggtcatccgcgcgctggcgttgcgcgagatcggt
cttggcgactggtggcgggtggcgctgcgcgagctgcccaccggcctggtgctgggcgcc
atgctcggcgtggtcggcgtctgccgcatcgcgctctggcagtatatgggcttctacgac
tatggcccgcactggccgctgatcgccaccacggtgggtgctgcactggtcggcatcgtc
accttcggttcgctgtcggggtcgatgctgccgttcgccttgaagcgcatcggcttcgat
ccggccagcgcatcggcgccgttcgttgccacgctggtcgatgtcaccgggctggtgatc
tatttctcggtggcgctggtgatcctgcgcggcacgctgctgtag

DBGET integrated database retrieval system