KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_4037Help
Entry
Mesci_4037        CDS       T01401                                 

Definition
(RefSeq) pyridoxal-dependent decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00350  Tyrosine metabolism
mci00360  Phenylalanine metabolism
mci00380  Tryptophan metabolism
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Mesci_4037
   00360 Phenylalanine metabolism
    Mesci_4037
   00380 Tryptophan metabolism
    Mesci_4037
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mci04147]
    Mesci_4037
Enzymes [BR:mci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Mesci_4037
    4.1.1.105  L-tryptophan decarboxylase
     Mesci_4037
Exosome [BR:mci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesci_4037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase DegT_DnrJ_EryC1 KIX_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 10119526
NCBI-ProteinID: YP_004143200
UniProt: E8TAZ6
Position
complement(4169206..4170615)
Genome map
AA seq 469 aa AA seqDB search
MNNDDFRQWSRRAADWGADYRNNLRDRPVRPLVEPGAISRSIEVSPPEDAEPMDRIFADF
EEKILPGMTHWQHPRFFAYFPANAAPVSVVAEYLVSAMAAQCMLWQTSPAATELETRTVD
WMRQALGLPEGFSGVLQDSASSATLAAVLTMRERALDWQGNKQGLAGQARLRIYSSDQVH
TSIDRAIWVSGIGEDNLVRIPVSGRFRAMDTAALEAAIVADREAGMLPAGIIACVGGTST
GGTDDIAAVAEVARRHGLYLHVDAAWAGSAMICPEYRHFWTGVEGADSIVFNPHKWLGAQ
FDCSIQFLRDPESHVRTLAIKPDYLKTHGHDGIINYSEWSVPLGRRFRALKLWFLLRAHG
LERLRTMIRNHVAWSEGLAARLAREPDFQIVSEPMLSLFSFRHKTATDGDEHNLRLVNAI
NDDGRIYLTQTKVDGLIAIRFQVGQFEATAADVETAFVVITEIARGLGR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgatgatttccggcaatggtcgcggcgcgccgccgactggggcgctgactat
cgcaacaatctgcgcgaccgccccgtgcggccactggtagaacccggcgccatttctaga
agcatcgaggtttcgccgcccgaagacgccgaaccgatggaccggatcttcgccgatttc
gaagagaagatcctgccgggaatgacgcattggcagcatccgcgcttcttcgcctatttc
ccggccaatgcggcgccggtttcggtggtggcggaatatctggtttcggcgatggccgcg
caatgcatgctgtggcagacgtcgccggcggcgaccgaactcgaaacgcgcaccgtcgac
tggatgcgccaggcgctcggtctgccggaaggcttctcgggcgtactccaggattcagcc
tcatcggcgacgttggccgcggtgctgaccatgcgcgaacgggcactcgactggcaaggc
aacaaacagggcctggcagggcaggcgcggctgcgcatctactcctccgaccaggtgcac
acgtcgatcgaccgggcgatctgggtgtccggcatcggcgaggacaatctcgtgcgcatt
cccgtcagcggccgctttcgcgccatggacacggccgcgctcgaggcggcaatcgtcgcc
gaccgggaagccggcatgctgccggcgggcatcatcgcttgcgtcggcggcaccagcact
ggcggcaccgacgacattgctgcggttgccgaggtggcacggcggcatgggctttatctc
catgtcgatgccgcctgggcgggatcggcgatgatctgtccggaatatcggcatttctgg
acaggcgtcgaaggcgccgattcgatcgttttcaatccgcacaaatggctgggcgctcag
ttcgactgctcgatccagttcctgcgcgaccctgaaagccatgtcaggacgctggccatc
aagccggattatctgaagacgcacggtcatgacggcatcatcaactattccgaatggtcg
gtaccgctcggcaggcgatttcgcgcgttgaaattatggttcctgctgcgcgcccatggc
ctggaacgcctgcgcacgatgatccgcaatcatgtcgcgtggagcgaagggctggcggcg
cggctggcaagggagccggatttccagatcgtcagcgaaccgatgctgtcgttgttctcg
ttccggcacaagaccgcaaccgacggggacgagcacaatctgcgccttgtcaatgcgatc
aacgacgatggccgcatctacctgacgcagacgaaggttgatggactgatcgcaatccgg
ttccaggtcggacagttcgaggcgaccgccgccgatgtcgaaacggcttttgtggtgatt
actgaaatcgcacgtggcctgggtcgctga

DBGET integrated database retrieval system