KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_4910Help
Entry
Mesci_4910        CDS       T01401                                 

Definition
(RefSeq) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Pathway
mci00361  Chlorocyclohexane and chlorobenzene degradation
mci00625  Chloroalkane and chloroalkene degradation
mci01100  Metabolic pathways
mci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mci00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mesci_4910
   00361 Chlorocyclohexane and chlorobenzene degradation
    Mesci_4910
Enzymes [BR:mci01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Mesci_4910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 10120408
NCBI-ProteinID: YP_004144066
UniProt: E8TNM1
Position
5043539..5044201
Genome map
AA seq 220 aa AA seqDB search
MQYAAYVFDAYGTLFDVHAAVRRHADRIGPDGQLLSEIWRAKQLEYSWVRTLMGAYADFW
QLTEQALDFALRKVPSADPGLKAILLDAYWRLDCYPEVPAVLKALKASGARLAILSNGSP
EMLQAAVKSAALDQVLDDIYSVDTVRRFKTDPAVYDMVATGRRLYPGAVSFQSSNRWDIA
GATKFGFRTVWINRSNQPEEYRDFPPALILPSLEALVPGS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacgccgcctatgtcttcgacgcctatggcacgctgttcgacgtgcatgccgcc
gtacgccgtcatgccgaccggatcgggccggacggccaattgctgtccgagatctggcgc
gccaaacagctcgaatattcctgggtgcgcacgctgatgggcgcctatgccgatttctgg
caactgaccgaacaggcgctcgatttcgccttgcgcaaggttccctcggccgaccccggt
ctcaaggcgatattgctggatgcctattggcggctcgattgctatccggaagtgccggcc
gtgctcaaggcgctcaaggcttcgggagcgaggctggcgatcctgtccaacggctcgccc
gaaatgctgcaggcggcggtcaaatccgccgcgctcgaccaggttctggacgatatctat
tccgtcgatacggtgcggcgcttcaagaccgatcccgcggtctacgacatggtcgccacc
ggccggcgcctctaccccggcgcggtttccttccagtcgtccaatcgctgggacattgca
ggcgccaccaaattcggctttcgcacggtgtggatcaaccgctccaaccagcccgaagaa
taccgggacttcccaccggccctgatcctgccgtcgctcgaagcccttgtgcccggcagc
taa

DBGET integrated database retrieval system