KEGG   Mesorhizobium ciceri: Mesci_4919Help
Entry
Mesci_4919        CDS       T01401                                 

Definition
(RefSeq) propanoyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00071  Fatty acid degradation
mci00072  Synthesis and degradation of ketone bodies
mci00280  Valine, leucine and isoleucine degradation
mci00310  Lysine degradation
mci00362  Benzoate degradation
mci00380  Tryptophan metabolism
mci00620  Pyruvate metabolism
mci00630  Glyoxylate and dicarboxylate metabolism
mci00640  Propanoate metabolism
mci00650  Butanoate metabolism
mci00900  Terpenoid backbone biosynthesis
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
mci01212  Fatty acid metabolism
mci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mesci_4919
   00630 Glyoxylate and dicarboxylate metabolism
    Mesci_4919
   00640 Propanoate metabolism
    Mesci_4919
   00650 Butanoate metabolism
    Mesci_4919
  Lipid metabolism
   00071 Fatty acid degradation
    Mesci_4919
   00072 Synthesis and degradation of ketone bodies
    Mesci_4919
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mesci_4919
   00310 Lysine degradation
    Mesci_4919
   00380 Tryptophan metabolism
    Mesci_4919
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mesci_4919
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mesci_4919
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mesci_4919
Enzymes [BR:mci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mesci_4919
Exosome [BR:mci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesci_4919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-GeneID: 10120417
NCBI-ProteinID: YP_004144074
UniProt: E8TNM9
Position
complement(5053976..5055142)
Genome map
AA seq 388 aa AA seqDB search
MTACIVGWTHSRFGKLEGETLENLIVKVATDALDHAGIGPDEVDEIVLGHFNAGFSAQDF
TASLVLQADDRLRFKPATRVENACATGSAAVRQGIRAIDANAARIVLVVGAEQMTTTPGP
EIGKNLLKASYLPEDGETPAGFAGVFGKIAQAYFQRYGDQSDALAMIAAKNHKNGVDNPY
AQMRKDFGYEFCRQESEKNPFVAGPLKRTDCSLVSDGAAALILADTATALKMRRAVAFRA
NEHVQDFLPMSKRDILTFEGCEQAWNRALKSAGVTLDDLSFVETHDCFTIAELIEYEAMG
LAKPGEGAKLALDGTTAKDGRLPVNPSGGLKAKGHPIGATGVSMHVLTAMQLVGEASGIQ
VPGAKLGGIFNMGGAAVANYVSILDRIR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatgcatcgtcggatggacgcattcgcgcttcggcaagcttgagggcgaaacg
ctcgaaaacctcatcgtcaaggtggcaacggacgcgctcgaccatgccggcatcggtccc
gacgaggtcgacgagatcgtgctcggccacttcaacgccggtttttcggcgcaggatttc
accgccagtctggtgcttcaggccgacgaccggctgcgcttcaagccggcgacgcgtgtc
gagaacgcttgcgccaccggatcggcggcggtccgccaaggcatccgcgccatcgacgcg
aatgccgctcgcatcgtgctggtggtcggcgcggagcagatgacgacgacgccggggccg
gagatcggcaaaaacctgctcaaggcgtcctatctgcccgaggacggcgagacacccgcg
ggtttcgccggcgtcttcggcaagatcgcgcaggcctatttccagcgttatggcgatcag
tcggatgcgctggccatgattgccgccaagaaccacaagaacggcgtcgacaatccctat
gcgcagatgcgcaaggatttcggctatgagttctgccgccaagagagcgagaagaacccc
ttcgttgccggtcctctgaagcgcaccgactgctcgctggtctccgacggcgccgccgcc
cttatccttgccgacaccgccacggcactgaagatgcgccgtgccgttgccttccgcgcc
aacgaacatgtgcaggatttcctgccgatgtcgaagcgcgacattctgaccttcgaaggc
tgcgagcaggcctggaaccgggcgctgaaatcggccggcgtgacgctcgacgatctgtcc
ttcgtcgaaacgcatgactgcttcaccattgccgaactgatcgagtacgaggcgatgggc
cttgccaagccgggagagggggcgaagctggcgttggacggcacaacggccaaggatggt
cgcctgccggtcaatccgtccggcgggctgaaggccaagggccatccgatcggcgccact
ggcgtgtccatgcatgtcttgaccgccatgcagcttgtcggtgaggccagcggcatccag
gtgccgggcgcaaaactgggcggcatcttcaatatgggcggtgcggcggtcgccaactac
gtttccattctcgaccggatcagataa

DBGET integrated database retrieval system