KEGG   Mesorhizobium ciceri biovar biserrulae: Mesci_5598
Entry
Mesci_5598        CDS       T01401                                 
Name
(GenBank) type IV secretory pathway VirB3 family protein
  KO
K03198  type IV secretion system protein VirB3
Organism
mci  Mesorhizobium ciceri biovar biserrulae
Pathway
mci03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mci00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mesci_5598
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mci02044]
    Mesci_5598
Secretion system [BR:mci02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Mesci_5598
SSDB
Motif
Pfam: VirB3 Gram_pos_anchor
Other DBs
NCBI-ProteinID: ADV14692
UniProt: E8TGH9
Position
complement(5781411..5781737)
AA seq 108 aa
MSDRLEVSTLYVAATRPALFLGVPLTLAGALMMLAGLVIIILKNPLYEVVLVPLWFGARL
IVERDYNAASVAFLYLQTAGRSVDGSVWGGASVSANPIRVPKRGRGMV
NT seq 327 nt   +upstreamnt  +downstreamnt
atgagcgaccggctggaagtgagcaccctctatgtggcggcgacacgccccgcactgttt
ttgggggtgccgctgacgctggccggagcgctcatgatgttggcgggactcgtcatcatc
atccttaagaacccgctctatgaagtcgtgctcgtgccactctggttcggagcacggctg
attgttgagcgcgactataacgccgcaagcgtggcgtttctctatttgcagaccgccggc
agaagcgtggatgggtcggtctggggcggggcgagcgtcagcgccaatccgatcagagtg
ccgaagcgcggaagaggaatggtgtga

DBGET integrated database retrieval system