KEGG   Mesorhizobium ciceri (biovar Biserrulae): Mesci_6387
Entry
Mesci_6387        CDS       T01401                                 

Definition
(RefSeq) type VI secretion protein, evpb/vc_a0108 family
  KO
K11900  type VI secretion system protein ImpC
Organism
mci  Mesorhizobium ciceri (biovar Biserrulae)
Brite
KEGG Orthology (KO) [BR:mci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mci02044]
    Mesci_6387
Secretion system [BR:mci02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mesci_6387
SSDB
Motif
Pfam: VipB VipB_2 TssC Top6b_C
Other DBs
NCBI-GeneID: 10113720
NCBI-ProteinID: YP_004134537
UniProt: E8TNT4
Position
pMESCI01:complement(334451..335962)
AA seq 503 aa
MIMAEQQKTASVAAEAEAINLDEFSGLLEKDFKVKKDDSEKLQQLVRNLALAAQSRSDTT
TISSNAIKSIKSLIAGIDKMLTTQVNEILHAPEVREMEGTWRGLWYLVNNTETDQKLKIR
VMNISKEQLADTLEDYEGQMWDQSPIFKKVYTDEYSMLGGEPIGCVIGAYEFSNHPRDVG
LLRNISGICASAHTPFIAAASPRLFRMDSWQELPNPQDLQQIVSNPAYASWQSLRESEDA
RYIGLTMPRVLARLPYGTDTVPVKGFTFEEEVEGDHNKYVWMNAAFPMGVNINRSHKLFG
WGTQIRGVENGGTVLNLPVHSFPTDDGSIAMKCPTEVAIDDRREAELAKLGLMPILHRKN
TDLAAFIGAHSLQDDETRAGRLVDPDAQSNERLSANLPYLFPVSRFAHYLKAIARDKVGS
FKERADMQIWLTEWINRYVLANPAFADDKARAKRPLAAAEVQVDSVEGRPGYYNARFYLR
PHYQLEGINASLRLVSELPSVKT
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgatcatggccgaacagcaaaagaccgcctcagtcgccgcggaggccgaagccataaac
ctcgatgaattcagcggactcctcgaaaaagatttcaaggtcaagaaggacgacagcgag
aagctgcaacagctcgtgcgcaatctcgcgctcgcggcgcagtcccgttccgacaccacg
accatctcttccaatgccatcaaatcgatcaagtcgctgatcgccggcattgacaagatg
ctgacgacacaggtcaacgaaatcctgcacgcgccggaagtgcgtgagatggaaggcaca
tggcgagggctgtggtatctcgtcaacaacaccgagacggatcagaagctgaagatccgg
gtgatgaacatctccaaagagcagctggccgatacgcttgaagactatgaaggtcagatg
tgggaccagagcccgatcttcaagaaagtctacacagacgagtattcgatgcttggcggc
gaaccaatcggctgcgtgatcggcgcctacgagttctccaatcacccacgtgacgtcggc
ctgctgcgcaacatctccggcatctgcgcttccgcgcatacgccgtttatcgcggccgct
tcgccgcgcctatttcgcatggacagctggcaggaactgccgaacccgcaagacctgcag
cagatcgtctccaaccccgcctatgcctcgtggcagtcgttgcgcgagagtgaggacgct
cgctacatcggcctgaccatgccccgcgtcctggcgcggctgccctacggcaccgatacc
gttccggtgaagggtttcaccttcgaggaagaggtggagggcgatcacaacaaatatgtc
tggatgaacgccgccttcccgatgggcgtcaacatcaaccgcagtcacaagcttttcggc
tggggcacgcagatccgcggcgtcgagaatggtggcacggtgctcaacctgccggtgcat
agcttcccgaccgatgatggctcgatcgcgatgaaatgtcccacggaagtcgccatcgac
gaccggcgcgaggcggaactggccaagcttggcttgatgcccatcctgcaccggaagaat
accgatctcgcggccttcatcggagcacactcgctgcaggacgacgaaacgcgggcgggg
cggctggtcgaccccgatgcacagtcgaacgagcggctgagcgccaacctgccctacctg
ttcccggtctcgcgctttgcgcactacctcaaggcgatcgcgcgcgacaaggtcggctcg
ttcaaggagcgcgccgacatgcagatctggttgaccgagtggatcaatcgatacgtgctg
gccaacccggcctttgccgacgacaaggcgcgcgccaagcgcccgcttgccgccgccgag
gtccaggtggacagcgtggaggggcggccgggctattataatgcccgcttctatctgcgc
ccgcattaccagctggagggcatcaatgcgtcgctccgactggtctcggaactaccgtcc
gttaagacttga

DBGET integrated database retrieval system