KEGG   Methanothrix soehngenii: MCON_0462Help
Entry
MCON_0462         CDS       T01468                                 

Definition
(GenBank) phosphatidylserine decarboxylase-like protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mcj  Methanothrix soehngenii
Pathway
mcj00564  Glycerophospholipid metabolism
mcj01100  Metabolic pathways
mcj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MCON_0462
Enzymes [BR:mcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     MCON_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AEB67311
UniProt: F4BWJ4
Position
complement(401287..401952)
Genome map
AA seq 221 aa AA seqDB search
MKLAKDSRGWISVPIILTAALAAAGNWYISAAAFMGLLFMIFFHRDPDRLPQSEGMLSPA
DGRIIQATPEKVTVFMGFGDVHVNRSPLDGTIISVEQRKGTHLPAFLNRSCQNQQNRIRI
DTEDGEIQLCQITGTFVREIICYVKPGDHVLRGERIGMIRFGSRVETTIPRGYKLQVAIG
DSVRAGKTVLAIKCNSELPGVPVASGSSGVLVSSGSPGVTS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctggcaaaagactcccgcggatggatatcggtgcccattatcctgaccgctgcc
ctggccgctgccgggaactggtacatatcggctgccgcttttatgggtttgctgttcatg
atattctttcaccgggacccagaccgtctgccgcaaagcgagggtatgctctctccagca
gacggaaggatcattcaggccacccctgagaaggtcaccgtattcatgggcttcggcgat
gtgcacgttaaccggtcgcctttagatgggacgataatcagtgtggagcaaaggaaaggc
actcacctcccagcctttctaaaccgctcgtgccaaaaccagcaaaacagaattagaatc
gataccgaggacggagagattcagctgtgccagatcaccgggacctttgtaagagagatc
atctgttatgtcaaacccggagatcacgtcctccggggggagaggataggcatgatccgc
tttggctcgcgggtggagaccaccattcccaggggatacaagctgcaagtggccattgga
gatagcgtccgggcggggaagacggttcttgccatcaagtgcaactcggagctgccagga
gttccagtggcatcaggttcatcaggagttctagtctcttctgggtcaccaggagtcact
tcatga

DBGET integrated database retrieval system