KEGG   Methanothrix soehngenii: MCON_0559Help
Entry
MCON_0559         CDS       T01468                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mcj  Methanothrix soehngenii
Pathway
mcj00010  Glycolysis / Gluconeogenesis
mcj00620  Pyruvate metabolism
mcj00640  Propanoate metabolism
mcj00680  Methane metabolism
mcj00720  Carbon fixation pathways in prokaryotes
mcj01100  Metabolic pathways
mcj01110  Biosynthesis of secondary metabolites
mcj01120  Microbial metabolism in diverse environments
mcj01130  Biosynthesis of antibiotics
mcj01200  Carbon metabolism
Module
mcj_M00357  Methanogenesis, acetate => methane
mcj_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_0559 (acsA)
   00620 Pyruvate metabolism
    MCON_0559 (acsA)
   00640 Propanoate metabolism
    MCON_0559 (acsA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCON_0559 (acsA)
   00680 Methane metabolism
    MCON_0559 (acsA)
Enzymes [BR:mcj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MCON_0559 (acsA)
Lipid biosynthesis proteins [BR:mcj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MCON_0559 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEB67397
UniProt: F4BX07
Position
complement(495267..497255)
Genome map
AA seq 662 aa AA seqDB search
MAEEKATAKTSVLLEETRIFEAPKDLAENSNVMKWMKEKGFKTEREMRLWCSANYIQFWG
EMAKTYADWFEPWSSTLEWKPPYAKWFVGGKCNVTHNCVDRHAQGAKKDKVAYIFVPEPT
DQPTQKITYAQLEKEVNKFANGLKSLGVVKGDRVMLYMPMIPQLPIAMLAIAKIGAIHCI
VFSGFSSGGLNSRIMDAEAKVVITVDGFYRRGKPLPLKPNVDEATANTPSVKNVVVCKRT
GVAVPMKEGKDIWWDDLVAGKSDACECEKMDSEDRLFILYTSGTTGKPKGIEHVHGGYQV
GPAQTLHWVFDVKDNDVWWCTADIGWITGHSYIVYGPLVLGATSIMYEGSPDFPDLGRWY
KIIQDNKVSVFYTAPTAVRMLMKAGDSWAKKYDVSSLRLLGSVGEPINPEAWMWYRNTFG
AGKLPIMDTWWQTETGTFLVSPLPITPLKPGSATFPLPGFNIDVLDEEANPVPLGSGGNI
VSNTPWPSMLRAFYRDPERYQKEYWSTYWDIRPGTYLAGDKAMKDKDGYFFIQGRIDDVL
KIAGHRISNAEVESALVSHPKVAEAAVIGKPDEVKGEVIVAFVILRTGQEETEELKKELA
KHVRTVLGPVAYPETVLFVKDVPKTRSGKIMRRVIKAKALGKPTGDLSALANPDAVDAIP
LI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
ttggctgaggaaaaagcaactgcaaagacatcagttttactggaagagacaaggatattc
gaggcacccaaggatctggcagagaactccaacgtaatgaagtggatgaaagagaaaggc
ttcaagacagagcgcgagatgcgcctctggtgctctgccaactacatccagttctgggga
gagatggccaagacctacgcagattggtttgagccctggtcctcaaccctagaatggaag
ccaccatatgccaaatggttcgtgggcggcaagtgcaatgtgacccacaactgcgtggat
aggcatgcccagggggccaagaaagataaggtggcctatatattcgtgcctgagcccacc
gatcagcccactcaaaagatcacttatgcacagctggaaaaggaggtcaataagttcgcc
aacggcctgaagagcctgggcgtggtaaagggagacagagtcatgttatacatgcccatg
atccctcaactgcccatcgccatgctggccatagccaagattggcgccattcattgcatt
gtattctctggattttcctctggcggcctgaacagcagaatcatggacgccgaggccaaa
gtggttattactgtggatggtttctaccggcgcggcaagccgctgcccctcaagccaaat
gtcgacgaagctacagctaataccccatcggtgaagaatgtagtggtgtgcaagaggacg
ggcgttgccgtccccatgaaagagggcaaagatatttggtgggacgaccttgtggccgga
aagtccgacgcatgcgagtgcgagaagatggattcagaggatcgcctgttcatcctgtac
acctctggaactaccggtaaacctaagggtattgagcatgtccatggcggataccaggtg
ggacccgctcagactctgcactgggtctttgatgttaaggacaatgatgtatggtggtgc
acagccgatatcggatggattaccggccacagctacattgtgtacgggccgctcgttctt
ggtgcaaccagcataatgtatgagggttctcctgacttcccagacctgggaaggtggtac
aagataattcaggacaacaaggtatcagtcttctacactgctccaacagcagtcaggatg
ttgatgaaggccggagattcctgggccaagaagtacgatgtttccagcctgaggctgctc
ggatctgtgggcgagcccataaatcccgaggcctggatgtggtatagaaacacctttggc
gctggcaagttgccgattatggacacctggtggcagactgagaccggcacattcctggta
tctcccctgcctataactccattgaagcccggctctgcgacattcccgctcccaggattc
aatatcgatgtcctggacgaggaagcaaacccggttcctctcggctctggaggcaatatc
gtcagcaacacaccctggccatccatgctcagggccttctacagagatcccgagaggtac
cagaaggagtactggtccacctactgggatatcaggcccggcacatacctggctggcgac
aaggcaatgaaagacaaggacggatacttcttcatccagggcaggatcgacgatgtgttg
aagattgcaggacacaggatctccaacgccgaggtggagtcggcactggtatctcacccc
aaggtggcggaggctgcagttatcggtaagcctgatgaggtcaagggtgaggtcatagtt
gccttcgtcatcctaaggactggacaggaggagactgaggagctgaagaaggaactggcc
aagcatgtccgcacagttttgggcccagttgcttatccggagacggtcttattcgtcaag
gatgtgcccaagaccagatccggcaagatcatgcgccgcgtcatcaaggccaaggcatta
ggaaagcccaccggagatctgtccgctctggccaaccccgatgcagttgatgccatcccg
ctcatctga

DBGET integrated database retrieval system