KEGG   Methanothrix soehngenii: MCON_1301Help
Entry
MCON_1301         CDS       T01468                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mcj  Methanothrix soehngenii
Pathway
mcj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mcj01100  Metabolic pathways
mcj01110  Biosynthesis of secondary metabolites
mcj01130  Biosynthesis of antibiotics
mcj01230  Biosynthesis of amino acids
Module
mcj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCON_1301 (trpC)
Enzymes [BR:mcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MCON_1301 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE QRPTase_C FMN_dh DHO_dh IMPDH PcrB His_biosynth Trp_syntA
Motif
Other DBs
NCBI-ProteinID: AEB67994
UniProt: F4C0I3
Position
1109706..1110437
Genome map
AA seq 243 aa AA seqDB search
MHSLIDGILEASRARGPAATELWPAEERRDLVASAAEAKRNGLIPIIAEIKPKALGRTLA
QEEVATYARAYAQYGACAISVLTEPTHFKGSLENARTARRAGLPVLRKDFIFSEVQLSEV
QADLVLLIAALDIDLDRFVAAARDLGMEPLVEVHSEKEMERALSTEARIIGINNRNLKTL
EVDLETFERLAPRARDAGVFLVAESGVHSPEDAVRMVRAGADALLVGTELMAGPERLGEL
NRL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcactccctgatagacggcatcctggaggcctcgcgggcgcgggggccggcggcgacg
gagttatggccggcggaggagaggagagatctggttgcctctgccgcggaggctaaaaga
aatggcctgataccaatcatcgccgagatcaagcccaaggcacttggcaggaccctcgct
caggaggaggtggcaacctacgctcgggcttacgcgcagtacggtgcctgcgccatatcc
gttctcaccgagcccacccacttcaagggcagtcttgagaatgcaaggactgctcgccgg
gcgggcttgccggtactgagaaaggacttcatattcagtgaggtgcaactctcggaggtc
caggcggatctggtgctgctcatcgccgccctggatatcgatttagatcggttcgtggcc
gcggccagggatcttggaatggagccattggtagaggtccattcggagaaagagatggag
agggccctgtcgacagaggccaggatcatcggcataaacaatcgcaatcttaagaccctg
gaggttgaccttgagaccttcgagcggctggcgccgcgggcaagagatgcgggggtattc
ctggtggcggagagcggggtgcacagcccggaggatgcggtgcggatggtgcgggctgga
gcggatgccctgctggtgggaacggagctgatggcggggccggagaggctgggggagcta
aacaggctttga

DBGET integrated database retrieval system