KEGG   Methanothrix soehngenii: MCON_2908Help
Entry
MCON_2908         CDS       T01468                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mcj  Methanothrix soehngenii
Pathway
mcj00010  Glycolysis / Gluconeogenesis
mcj01100  Metabolic pathways
mcj01110  Biosynthesis of secondary metabolites
mcj01120  Microbial metabolism in diverse environments
mcj01130  Biosynthesis of antibiotics
mcj01200  Carbon metabolism
mcj01230  Biosynthesis of amino acids
Module
mcj_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_2908
Enzymes [BR:mcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MCON_2908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEB69267
UniProt: F4C0S9
Position
complement(2471934..2473088)
Genome map
AA seq 384 aa AA seqDB search
MKCNAGFVGFDGTENKRTLLATAEVKKAAGIDGDLNVLLRKPHGRARSIMAKFNRLYGVK
AYLSDMALKDKWQAAGVTIEGGYDDFFSASDFIMVGTPGDQELPYLEAGLANDCFVSLMG
GADRPGLLKGLEENKKVKITEELKADFAREFFFGLENYQMFLNAKPKLVQCTSCNTTGLS
RLALAARPLGLTAVLGNIDRRHGDPHTVVKASPSAIQFGKGAGHQGTDAGTIFEEVNFSI
RASKVPTTVPHTNFLNLVFKGDVTASQLVEQYAKTREVVVMPYQDEGKKHDWTSEILEAF
LSGIERPISPEIFELIVSDAIIPFRLGDYTILQTVSMVEQMSIAVPNHVESYLLSAGYPA
DDVHSLVDKTLGIMHGIWPDKLSC
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtgtaatgcaggctttgtgggtttcgatggaacagagaataaaaggactcttctt
gctaccgcagaggtcaagaaagcggctggaatcgatggcgatctgaatgtgctcctcaga
aaacctcatggccgggccaggtctatcatggccaagttcaaccgcctttacggggtgaag
gcctatctcagcgatatggcccttaaggataagtggcaggccgcaggggtgacgatcgaa
ggcggatacgatgacttcttttctgcatccgattttatcatggtgggaacccccggagac
caggagctgccctacctggaggcgggcctggccaacgactgcttcgtctccctcatggga
ggagcagaccggcctgggctcctgaagggattggaggagaacaagaaggtcaagatcaca
gaggagctgaaagcggacttcgcccgagagttcttctttggtctggaaaactatcagatg
ttcctaaatgccaaaccgaagctggtgcagtgcacaagctgcaacaccacgggcctctcc
cggctggctctggccgcccggcccctgggccttaccgccgtcctggggaacatcgaccgc
aggcatggagatccgcatactgtggtcaaggcctcgcccagcgccattcagttcggcaag
ggagctggccaccagggaacagatgctggaaccatcttcgaggaggtcaacttctccatc
cgggcgagcaaggtgccaaccaccgtcccccacaccaacttcctgaatctggtcttcaag
ggagatgtgactgcaagtcagctggtagagcagtacgccaagacaagagaagtggtggtg
atgccctatcaggacgagggcaagaagcacgattggaccagcgagatcttagaggctttc
ctatccggcatagaaaggcccatcagcccggagatattcgaactcatagtctccgatgcc
ataatcccctttaggcttggcgactacaccatccttcagacagtctccatggtggagcag
atgtccatcgccgtgccaaaccacgttgagtcctatctgctttctgcaggctatcccgca
gacgacgtgcactctctggtggataagaccctgggcatcatgcatggcatctggccggat
aaactgagctgctga

DBGET integrated database retrieval system