KEGG   Methanothrix soehngenii: MCON_3444Help
Entry
MCON_3444         CDS       T01468                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mcj  Methanothrix soehngenii
Pathway
mcj00790  Folate biosynthesis
mcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCON_3444 (folP)
Enzymes [BR:mcj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MCON_3444 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEB69676
UniProt: F4BVR3
Position
complement(2897870..2899135)
Genome map
AA seq 421 aa AA seqDB search
MLKVIEGLLGWVKVGDIQPVRLMGVINLSRESFYKGSVASSNEALATARRLQDEGADIID
LGAVSTAPGSPPISEEVEKDRLFAALKEITDNLDIVVSVDTQRAKIAEKALSCGATCIND
VSGLHDPDMASKVAEYDGSLIIMASDQRPGDLPLLNQIIPLLGDKVRQAVRAGVALNKIS
IDPGIGKWIPVRTAAQDLAILDGFDRLRAIGRPVVAALSRKTFIGESLNIPDPGGRLAGS
LAATTVAVYLGAHIVRTHDISASLDAIAMAGAIRGRPIVTSDCSMDCDVDEHAVGDMQVE
VLGYLGQGMDLAEHLKRIQVDEGAYQLLSRKGSFRILAVRGLSSMEALIIKQEMLARGGD
AAIPKMALRCDKRPQEILILGTHAQISSLVRNLKGQPFRLGHLAAIIEEALELIDRPERY
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaaagtgattgaaggcttgttgggttgggtgaaggttggagatattcagcccgtg
cggctgatgggggtcatcaacctcagccgggagtcgttctataagggctcagtggccagc
tcgaatgaggctctagcaactgccaggcgactgcaggatgagggagctgatatcattgac
ctgggtgcggtctctaccgccccgggatctccccccataagcgaagaggtggagaaggac
aggctctttgccgccttaaaggagatcacggataacctggatatcgtggtctccgtagat
acccaaagggcgaagattgcagaaaaggccctgtcctgtggagctacttgcatcaacgat
gtctctggcctgcacgatcctgatatggcctcaaaggtagcagaatatgacggctctctg
atcatcatggcatcagatcaaaggcctggagacctgcctttgttgaatcagatcattccc
ctcctgggagacaaagtgaggcaggcagtgagagcaggagttgctctgaataagatctcc
atagatccagggatcggcaagtggattcccgtgaggacggcagcccaggacctggccatc
ctggatggctttgaccggttgcgcgccatcgggcggccggtagtggctgctttatcccgt
aagacattcatcggggagagcctgaatattcccgatcctggagggaggcttgccggaagc
ctggcagcaacgacagtagccgtctatctgggggcacatatcgtccgaacgcacgacatc
tccgccagcctggatgcgatcgccatggctggtgccatccgcggacggccgattgtgacc
agcgattgcagtatggattgcgatgtggatgaacatgcagttggcgatatgcaggtcgag
gttttgggctatctcggccagggaatggatctggcagagcatctgaagcggatacaggtg
gatgagggggcataccagctcctctcccggaagggatcttttcggatcctggcggtgcgg
ggcctgagcagcatggaggccctgataataaagcaggagatgctcgcccggggaggagat
gccgccattccaaagatggccctgcgctgcgataagcggccgcaagagattttaatcctc
ggcactcatgctcaaatatcaagcctggtcaggaacctgaaagggcagcctttccggctc
ggccatttggccgctatcattgaggaggccctggagctgatcgacagaccagagcgttac
aggtga

DBGET integrated database retrieval system