KEGG   Mycoplasma canis PG 14: AXW82_02790Help
Entry
AXW82_02790       CDS       T04557                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mck  Mycoplasma canis PG 14
Pathway
mck03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mck00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AXW82_02790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mck03011]
    AXW82_02790
Ribosome [BR:mck03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AXW82_02790
  Bacteria
    AXW82_02790
  Archaea
    AXW82_02790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Thioredoxin_15 DUF226
Motif
Other DBs
NCBI-ProteinID: AMD81457
Position
complement(715567..715911)
Genome map
AA seq 114 aa AA seqDB search
MNKQQAKAHVKLQRVSVSKAKLVANLFRGKNVDVALGILHNTSKKSSPIFIKLLNSAIAN
ATNNHGMNASKLFVKEVYVNEGPTLKRFQPRSRGNAYSIFKRTSNLSVVLEERN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaacaagcaaaagctcacgttaagttacaaagagttagcgtttctaaagct
aaattagttgcaaacttatttagaggtaaaaacgttgacgttgcattaggtatcttacac
aacacatcaaaaaaatcatcaccaattttcattaaattattaaattcagcaatagcaaat
gcaacaaataaccacggaatgaacgcatcaaaattattcgttaaagaagtttatgtaaat
gaaggtcctactcttaaaagatttcaaccaagaagtagaggtaatgcttattcgattttc
aaacgtacatctaatttatcagtagtattagaggagagaaactaa

DBGET integrated database retrieval system