KEGG   Macrococcus caseolyticus: MCCL_0078Help
Entry
MCCL_0078         CDS       T00848                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
mcl  Macrococcus caseolyticus
Brite
Enzymes [BR:mcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MCCL_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 UPF0227 PGAP1 DUF676 Abhydrolase_1 DLH DUF1057 Abhydrolase_6 Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: BAH16785
UniProt: B9E974
Position
complement(80693..81256)
Genome map
AA seq 187 aa AA seqDB search
MLKIKAPQTVYFQGNDHAVLLLHSFTGTTRDMKLIGDALAEADFSYMIPAYPGHGQPIET
FIQHSIMDWWKVVEEAYLQLLAQGFQKISVIGVSLGGLFTLKLVEQFNFHQAIIMSTPMH
KEAVNLEERLKHYAENTQKIFSENELSENNINNLIKNYYGTPLFIQMIDEIMTHLSDIQT
PIELKKK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaattaaagctccacaaacagtttatttccaaggaaatgatcacgcagtactc
ttactccattcattcactggtacgacaagagatatgaagttaattggtgatgcattagca
gaagcagatttttcatatatgattcctgcttatccaggacacgggcagcctattgaaaca
tttatacagcattcaataatggactggtggaaagtagttgaagaagcgtatttacaactg
ctcgcccaaggttttcaaaaaatatctgtaattggtgtctcacttggtgggctattcacc
ttaaagttagtggaacaattcaattttcatcaagcaatcattatgagtaccccgatgcat
aaagaagctgtaaatttagaagagagattgaagcattatgcagagaacacacaaaaaata
ttctctgaaaatgaactttcagagaataatatcaataatctaataaaaaactattatggc
actcctttgttcatacaaatgattgatgagattatgactcatctatctgatattcaaaca
ccgatagagctcaagaagaagtga

DBGET integrated database retrieval system