KEGG   Macrococcus caseolyticus: MCCL_0200Help
Entry
MCCL_0200         CDS       T00848                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mcl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MCCL_0200 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mcl03011]
    MCCL_0200 (rplV)
Ribosome [BR:mcl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MCCL_0200 (rplV)
  Bacteria
    MCCL_0200 (rplV)
  Archaea
    MCCL_0200 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAH16907
UniProt: B9E9J6
Position
206585..206959
Genome map
AA seq 124 aa AA seqDB search
MEAKAVARTIRIAPRKVRLVLDLIRGKEVAEAIAILKLTNKASSPVVEKLLMSALANAEH
NYDMNIDSLVVKEAYANEGPTLKRFRPRAQGRASAINKRTSHITIVVADKEVKTSNTEAQ
EEAK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaaaagcggttgcaagaacaatcagaatcgcacctcgtaaagtgagattagtt
ttagatcttatcagaggtaaagaagtagcggaagctatcgctattttaaaattaacaaac
aaagcatcatcacctgtagttgaaaagttattaatgtcagcattagcaaatgcagagcat
aactatgatatgaacattgattctttagttgttaaagaagcttatgcaaacgaaggacca
actttaaaacgtttccgtccacgtgcacaaggtcgtgcaagtgctatcaataaacgtaca
agccacatcactatcgttgtagctgacaaagaagttaaaacttcaaacactgaagctcaa
gaagaagcaaaataa

DBGET integrated database retrieval system