KEGG   Macrococcus caseolyticus: MCCL_0363Help
Entry
MCCL_0363         CDS       T00848                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00020  Citrate cycle (TCA cycle)
mcl00620  Pyruvate metabolism
mcl01100  Metabolic pathways
mcl01110  Biosynthesis of secondary metabolites
mcl01120  Microbial metabolism in diverse environments
mcl01130  Biosynthesis of antibiotics
mcl01200  Carbon metabolism
Module
mcl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCCL_0363
   00620 Pyruvate metabolism
    MCCL_0363
Enzymes [BR:mcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     MCCL_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 K_oxygenase NAD_binding_8 Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: BAH17070
UniProt: B9EA09
Position
complement(381114..382613)
Genome map
AA seq 499 aa AA seqDB search
MNKQESKTIVVIGAGVLSTTFSSMLKELEPSWNIKLYERLDRPGLESSNERHNAGTGHAA
LCELNYTVKQPDGSIDIEKAKEINEQFEISKQFWGHLVKSKNISDPKDFIQPLPHISFVR
GKNNVQFLKDRYHVMKESPMFDNIEFTEDIEEMRKWIPLMMQGHSSSDIMAASKINEGTD
VNFGELTRKMAQNIEQHPNADVHYNHEVIDFNQRQDGKWEVKVRQLNSGDVQTEIADYVF
IGAGGGAIPLLQKTGIPESKNLGGFPITGQFLICTNPDIIAQHEAKVYGKEPHGTPPMTV
PHLDTRYIDGERTLLFGPFASIGPKFLKNGSNLDLFKSVKPYNIATLLSSAVKNLPLIKY
SIDQILMTKEGCMNHLRTFYPEARDEDWELYTAGKRVQVIKDTPEYGKGFIQFGTEVVNS
KDHTVIALLGESPGASTSVSVALEVLEKNFPEYESEWTPKIKEMIPSYGQSLIDDTELMK
KIRQQTSKDLELNYYENDK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacaagagtcaaaaacaattgttgttattggcgctggggttttaagtacaacg
tttagttctatgcttaaagaattagaaccaagttggaatataaaactttatgaacgttta
gaccgccctggtctcgaaagttcaaatgagcgtcataacgcaggaacaggtcacgctgct
ttatgtgaattgaactatacagtgaaacaacctgatggatcaatcgacattgaaaaagca
aaagaaattaatgaacagtttgaaatttcaaaacagttttggggacatttagttaaaagc
aaaaatatttcagaccctaaagacttcattcaaccattacctcacatcagttttgttaga
ggtaaaaataacgtccaattcttaaaagatcgttatcatgtgatgaaagaatctccaatg
ttcgataatatcgaatttacagaagatatcgaagaaatgagaaaatggattccattaatg
atgcaaggtcacagttcaagtgatattatggccgctagtaaaatcaatgaaggtacggat
gtgaactttggagagctaacacgtaaaatggctcaaaatattgaacagcacccaaatgct
gatgttcattacaatcacgaagttatcgattttaatcaaagacaagatgggaaatgggaa
gtaaaagtacgtcaacttaatagtggtgacgttcaaactgaaattgctgattatgtattt
atcggtgctggtggcggtgcaatcccactattacaaaaaacaggtattcctgaaagtaaa
aatctaggcggcttcccgattacaggtcaattcttaatttgtactaacccagacatcatc
gcgcaacatgaggcgaaagtctatggtaaagagccacatgggacaccaccaatgactgta
ccacacttagatacacgttatattgatggtgaacgtacattactattcggtccattcgca
agtattggccctaaattcttaaaaaatggttctaatttagatttatttaaatctgttaaa
ccatataatattgcaacattattatcttctgcagttaagaatttacctttaatcaaatat
tctatcgaccaaatcttaatgactaaagaaggttgtatgaaccatttacgtacattctac
ccagaagcacgtgacgaagattgggaattatatacagcaggtaaacgtgtacaggtcatt
aaagacacacctgaatatggtaaaggatttattcaattcggtacagaagttgttaactct
aaagatcatacagtgattgcactattaggagaatctccaggagcatcaacttcagtttca
gtagcattagaagtacttgagaaaaacttccctgaatatgaatctgaatggacacctaaa
attaaagaaatgataccgtcatatggtcaatcacttattgatgacacagaattgatgaaa
aaaattcgtcaacaaacatcaaaagatttagaactaaattattacgaaaacgataaatag

DBGET integrated database retrieval system