KEGG   Macrococcus caseolyticus: MCCL_0403Help
Entry
MCCL_0403         CDS       T00848                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
mcl  Macrococcus caseolyticus
Brite
KEGG Orthology (KO) [BR:mcl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MCCL_0403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: BAH17110
UniProt: B9EA49
Position
430801..431811
Genome map
AA seq 336 aa AA seqDB search
MEPIIIFTFAIVFFALAFDFINGFHDTANAIATAVSTKALKPRHAILMAAVLNFIGAILF
HGVAKTVTKDIVDPFTLQNGQVVILAALISAITWNLITWYFGIPSSSSHTLIGSIAGAAI
ASGGFGILEYAGFTKIIVGLLISPLLAFIVGYIMYTIIKTIFKNANLTKTNRNFRFLQIF
TAAAQAFAHGSNDAQKAMGIITMALISAGMQTGSTEPQTWVQISCAAAMGLGTAVGGWKI
IKTVGGNIMKIRPANGVAADLSSAFIIFGATHFHLPVSTTHVVSSSILGVGSSHRVKGVK
WTTAQRMIITWVITLPISALIAAIIYFAVNFITHIF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgattattatttttacatttgcgattgtattcttcgcgttagcttttgatttt
atcaacggttttcacgatacggcaaacgcaatagcaacagcagtttcaacgaaagcactg
aagccacgtcatgcaatcttgatggctgctgtgcttaactttatcggggcgattcttttt
catggggtagcgaagacggttacgaaagatattgtagacccgtttacgttacaaaatggt
caagtggtcatccttgcggcattaatcagtgcgattacatggaacttaatcacatggtat
tttgggattccgagttcgtcatcacatacattgattggctcaattgcaggtgctgcaatt
gcatcaggtggttttggaattctggaatatgcaggatttacgaagattattgtaggatta
ttgatttcaccattacttgcattcatcgttggttatattatgtataccattattaaaaca
atatttaagaatgcaaacttaacaaagacaaatcgtaattttaggttcttgcaaatattc
acagcagcagcgcaagcatttgcgcatggttcaaatgatgcgcaaaaggcgatgggtatt
attacgatggcattaatctctgctgggatgcaaactggaagtaccgaacctcagacatgg
gttcaaatctcctgtgctgctgctatgggattaggtacagcagttggtggatggaagatc
attaaaacagttggtggtaatatcatgaaaattcgtccggccaatggtgttgcagcagac
ttgtcatctgcttttatcatctttggagcaacacattttcatctacctgtatccacaacg
cacgttgtatcctcttcaattctaggtgtcggatcgagtcaccgtgtaaaaggcgtgaag
tggacgacggcacagcgtatgattattacatgggtgattacattgccgatttcagcctta
attgcagcaattatctattttgctgttaactttattacacatattttttaa

DBGET integrated database retrieval system