KEGG   Macrococcus caseolyticus: MCCL_0896Help
Entry
MCCL_0896         CDS       T00848                                 

Gene name
bsaA
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00480  Glutathione metabolism
mcl00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MCCL_0896 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MCCL_0896 (bsaA)
Enzymes [BR:mcl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MCCL_0896 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: BAH17603
UniProt: B9EBJ2
Position
complement(990710..991183)
Genome map
AA seq 157 aa AA seqDB search
MSIYEYTVTKANHESYSLAEYKNQVVLIVNTASECGFTKQFDGLEKLYQEYKGQGFTVLG
FPCNQFGGQEPGSGAEAEQNCRLNYGVTFPIHEKIEVNGDNAHPLFKYIKEETKGIMGSK
IKWNFTKFLVDRQGNVVARFAPTTTPEQLKKHIEKYL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtctatatacgaatatacggttactaaagcaaatcatgaatcatattcacttgcagaa
tacaaaaatcaagttgttctaattgttaatactgcgagcgaatgtggatttacaaaacag
tttgatggacttgaaaaactctaccaggaatataaaggacaagggtttactgtattggga
ttcccttgtaatcaatttggaggccaggaacccggaagtggggctgaagctgaacagaat
tgtcgtttgaactatggcgttacgttcccgattcatgaaaaaatagaagtgaatggagat
aacgcacacccgctgtttaaatatataaaagaagagacaaaagggatcatgggcagtaag
atcaaatggaatttcacaaaatttttagttgatagacaaggtaacgttgttgcgcgtttt
gcacctacaactacacccgagcaattgaaaaagcatatagaaaaatatctataa

DBGET integrated database retrieval system