KEGG   Macrococcus caseolyticus: MCCL_1191Help
Entry
MCCL_1191         CDS       T00848                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00010  Glycolysis / Gluconeogenesis
mcl00052  Galactose metabolism
mcl00500  Starch and sucrose metabolism
mcl00520  Amino sugar and nucleotide sugar metabolism
mcl00521  Streptomycin biosynthesis
mcl01100  Metabolic pathways
mcl01110  Biosynthesis of secondary metabolites
mcl01120  Microbial metabolism in diverse environments
mcl01130  Biosynthesis of antibiotics
mcl01200  Carbon metabolism
Module
mcl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCCL_1191
   00052 Galactose metabolism
    MCCL_1191
   00500 Starch and sucrose metabolism
    MCCL_1191
   00520 Amino sugar and nucleotide sugar metabolism
    MCCL_1191
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MCCL_1191
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MCCL_1191
Enzymes [BR:mcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MCCL_1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAH17898
UniProt: B9E6T0
Position
complement(1294382..1295350)
Genome map
AA seq 322 aa AA seqDB search
MILAADIGGTTCKLGILDSNLNIIKKWEIVTNKDDNGTHILKNIYDSFIKHLSAVNLTIK
DCIGVGLGVPGPVDFNNGIINGAINLNWHGKINIKAQFEALSGLPVYVDNDANVATLGEK
FRGAGRNEPDVVCVTLGTGVGGGIVSNHELIHGFNGAAGEFGHITVDTKQRFKCNCGKNG
CLETVASATGVVNLAYHYYKELQFKTVIEDAIRNKELQAKMIFDAAKAGDEFSLYVIKKV
AKHLAYAFSIISVMTNPKHIIIGGGVSKAGQFLVDHIEQYYKDLTFLPAYEGTKIVTAEL
GNDAGMIGAAGLIKIYILGEKI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagcagcagatataggtggaacaacttgtaagctaggtatattagactcaaac
ctcaatattattaaaaaatgggaaatcgttacgaataaagatgataacggaacacatata
ttaaagaacatttatgattcatttattaaacatttaagtgctgtaaatttaaccattaaa
gactgcataggtgtgggtctcggtgtaccaggtccggtagattttaacaatggtattatc
aatggagcgattaacttaaactggcatggtaagattaatattaaagcgcagtttgaagca
ctaagcggattaccagtatatgtagataatgatgcaaatgtagcgacgctcggtgaaaaa
tttcgaggagcgggtagaaatgagcctgatgtcgtatgtgtaaccctaggtacaggcgta
ggtgggggtatcgtcagtaatcatgagctcattcatggattcaatggtgcagcaggagaa
ttcggacatattactgtagatacgaagcagagatttaaatgtaactgtggaaaaaacggc
tgtcttgagacggttgcaagtgctacaggggtggtaaatttagcctatcattattacaaa
gagctgcaatttaagactgtaatcgaagatgcaatcagaaataaagagcttcaggcaaag
atgatatttgatgccgcaaaagcaggggatgagttttcattatatgtgattaagaaagta
gcgaaacatctcgcttatgcatttagtattatcagtgtcatgacaaatcctaagcacatt
atcattggcggaggggtctctaaagcaggacagtttcttgtagatcatatcgaacagtat
tataaagatttaacgttccttccagcttatgaaggaacaaagatagtaactgctgagcta
ggcaatgatgcaggcatgattggtgctgcaggtttaatcaaaatttatattctaggagag
aagatataa

DBGET integrated database retrieval system