KEGG   Macrococcus caseolyticus: MCCL_1430Help
Entry
MCCL_1430         CDS       T00848                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00300  Lysine biosynthesis
mcl01100  Metabolic pathways
mcl01120  Microbial metabolism in diverse environments
mcl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MCCL_1430
Enzymes [BR:mcl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MCCL_1430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer PFL-like
Motif
Other DBs
NCBI-ProteinID: BAH18137
UniProt: B9E7G9
Position
complement(1549575..1550984)
Genome map
AA seq 469 aa AA seqDB search
MWREKVAQYEDKIIEDLTGLLNIRSVRDDSLADEAHPVGPGPREALDYMYKLAQRDGFNT
HDVDHIAGRIEAGKGEKVFGILGHVDVVPEGSGWDTDPFNATVTEDRIIARGTLDDKGPT
IAAYYAVKILEDMQVDWKKRIHIIIGTDEESEWKCTERYFETEPMPDLGIAPDADFPLIH
GEKGFSSFDIIQTSDEESEKTPEVVLKALKSGERYNMVPDHAEAQLSVNEQMAYVIQSFE
GFLKDYSLEGKHYVENGQLKLEVEGKSVHGMEPFKGINAGLYLIHFLNTLDLDKKAKDFV
SLGDDKLFDSHFGEKLGVATETEELGKLTTNIGIISYTDVDGGVYGVNLRYPNGFEFDKE
IEKISQTLAPYFEIEVTKHQVPHYVDKNDPFVMKLLQAYRNQTGDMTEPYTIGGGTYART
MEKGVAFGAMFKDSEDLMHQKNEYITKKQLFDATAIYLEAIHSVCVEEA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtggagagaaaaagtagcacaatatgaagacaagattatcgaagacttaacaggcctt
ctgaatattcgcagtgtccgcgatgatagtcttgcagatgaagcgcatcctgttggtcca
ggaccacgtgaggcgctggattacatgtataaattagcacagcgcgatggattcaatacg
catgatgttgatcatattgctggacgtattgaagcgggtaaaggagaaaaggtctttggt
atcttaggacatgtcgatgttgtgcctgaaggcagtggctgggataccgatccatttaat
gcaacggttactgaagaccgaatcattgcacgtggaactttggatgataaaggaccgaca
attgctgcttactatgcagtgaagatcttagaagatatgcaggtagactggaagaaacgt
atacatatcattattggtacggatgaagagtcagagtggaaatgtaccgagcgctatttt
gaaactgaaccgatgccggatctaggtatcgcacctgacgcagactttccgttaatccat
ggcgaaaaaggtttttcatcatttgatatcattcagacaagtgatgaggaaagtgaaaag
acaccagaagtcgtattgaaagctttaaaatcaggtgaacgttacaatatggtacctgat
catgcagaggcgcagttaagtgtcaatgaacaaatggcatatgttatccagagttttgaa
gggttcctaaaggactacagccttgaaggaaaacattatgtagagaatggtcagctgaaa
ttagaggtagaagggaagtctgtgcatggtatggagccgttcaaaggtatcaatgcagga
ttgtatttaatccacttcttaaatacgcttgatctagataagaaagcgaaagatttcgta
tcattaggtgatgataaattatttgattcacactttggagaaaagctcggtgtcgcgaca
gaaactgaagaattagggaagttaacaacgaacatcggtatcatcagttatactgatgtg
gatggtggtgtatatggtgtcaacttgcgttatcctaatggctttgaattcgacaaagag
attgaaaaaatttcacaaacattggcaccgtactttgaaattgaagtgacaaaacatcaa
gtaccacattatgtcgataaaaatgatccatttgtaatgaagttgctacaagcttatcgc
aatcagacaggggatatgacagaaccttatacgattggtggcggaacgtatgcccgtaca
atggaaaagggtgttgcatttggtgcgatgtttaaagattcagaagatctgatgcatcag
aaaaatgagtacatcactaaaaaacaattatttgatgctactgcaatttacctggaagca
atacattcagtatgtgtagaagaggcatag

DBGET integrated database retrieval system