KEGG   Macrococcus caseolyticus: MCCL_1435Help
Entry
MCCL_1435         CDS       T00848                                 

Gene name
leuS
Definition
(GenBank) leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00970  Aminoacyl-tRNA biosynthesis
Module
mcl_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MCCL_1435 (leuS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mcl01007]
    MCCL_1435 (leuS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mcl03016]
    MCCL_1435 (leuS)
   03029 Mitochondrial biogenesis [BR:mcl03029]
    MCCL_1435 (leuS)
Enzymes [BR:mcl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     MCCL_1435 (leuS)
Amino acid related enzymes [BR:mcl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MCCL_1435 (leuS)
Transfer RNA biogenesis [BR:mcl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MCCL_1435 (leuS)
 Prokaryotic Type
    MCCL_1435 (leuS)
Mitochondrial biogenesis [BR:mcl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MCCL_1435 (leuS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 tRNA-synt_1_2 tRNA-synt_1g Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: BAH18142
UniProt: B9E7H4
Position
complement(1555756..1558164)
Genome map
AA seq 802 aa AA seqDB search
MSFNHQTIEKKWQKYWLDNHTFKTTEDKDKNFYALDMFPYPSGAGLHVGHPEGYTATDII
SRFKRMQGYNVLHPMGWDAFGLPAEQYAIDTGNDPAEFTEKNIATFKRQIQELGFSYDWE
REINTTDPEYYKWTQWIFIQLYKKGLAYVDEVAVNWCPALGTVLSNEEVIDGVSERGGHP
VIRKPMRQWVLKITEYADRLLEDLEELDWPESLKDMQRNWIGRSEGAEVAFEVENLDHSF
KVFTTRPDTIYGATYAVLSPEHELVAAITSEEQAEAVKAYQEQAARKSDLERTDLAKDKT
GVFTGSYAINPFNGERMPIWISDYVLASYGTGAIMAVPAHDERDFEFAKQFGLDIKPVIE
GGDNTSAYTGDGAHINSGELDGLNKEEGIRRAIELLEAKGIGEKKVSYKLRDWLFSRQRY
WGEPIPVITWEDGSMTTVPEEELPLMLPKTEHIKPSGTGESPLANIDEFVNVTDPVTGMK
GRRETNTMPQWAGSCWYYLRYIDPKNSDMIADPELLKKWLPVDLYIGGAEHAVLHLLYAR
FWHKVLYDLGVVHTKEPFQKLFNQGMILGEGNEKMSKSKGNVVNPDDVVASHGADTLRLY
EMFMGPLDASIAWSTNGLDGARRFLDRVYRLLVNEDGTLSEKITEQPVGSMEKVYHQTVK
KVTDDYETLGFNTAISQMMVFINEGYKSEQLNIDHIRGFVKLLNPIAPHITEELWEKLGG
TESITYEAWPVYDESKLVDSEVEIVIQVNGKLKQKATIAKDMDKSEMETFALSLEAVQTA
IEGKTVRKVIAVPNKLVNIVAN
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaatcatcaaacaattgagaagaaatggcagaagtactggttagataaccac
acatttaaaacgactgaagataaggataagaatttctatgcattagatatgttcccgtac
ccatcaggtgctggtcttcacgttggacatcctgagggctacacagcaacggatatcatt
tctcgttttaagcgtatgcaaggttataacgtattacatccgatggggtgggacgcattc
ggactgccagcagagcaatatgcaatcgatacagggaatgatccggcagaattcaccgag
aagaatattgcgacattcaaacgtcaaattcaagaactgggcttcagctatgactgggag
cgcgaaattaatacgacagaccctgagtattataagtggacacagtggatcttcatacag
ctgtataaaaaaggtttagcatatgtggatgaagtagcagtgaactggtgccctgctctc
gggaccgtattatcaaatgaagaagtaattgatggtgtatcagagcgtggtggacaccct
gtgattcgtaaaccaatgcgtcagtgggtccttaaaattactgaatatgcagatcgttta
ctggaagatctagaagagctggactggccggaatctctaaaagatatgcagcgtaactgg
attggtcgctcagaaggtgctgaagttgctttcgaagttgaaaatttagaccattcattt
aaagtatttacaacacgtccagatacaatttatggtgcaacttatgcggtattatcacct
gagcatgaattagttgcggcaattacatcagaagaacaagcagaagcggtaaaagcatat
caggaacaggcagcaagaaaatctgaccttgaacgaactgatcttgcgaaagacaagaca
ggggtctttacaggaagttatgcaatcaatccatttaatggagaacgtatgccgatctgg
atttctgattacgtactagcttcatatggtacaggtgcaattatggcagtaccagcacat
gatgagcgtgactttgaatttgcgaaacagttcggattagacattaaaccagtgattgaa
ggtggcgataatacatcagcttacacaggtgatggtgctcatatcaactcaggtgaactt
gatggcctgaacaaagaggaaggaatcagacgtgcaatcgagctgttagaagctaaaggt
atcggtgaaaagaaagtatcttacaaactacgtgactggttgttctctcgtcaacgttac
tggggtgaaccaattcctgtaattacatgggaagatggttcgatgacaactgtacctgaa
gaagaattaccactgatgctaccgaagacagaacacatcaagccatcagggacaggagaa
tcaccacttgcgaacattgatgaatttgtcaatgtcacagatcctgttacagggatgaaa
gggcgccgtgaaacgaatacgatgccacaatgggcgggtagctgctggtattacttacgt
tacatcgatccgaagaattctgacatgatcgcagatcctgagcttcttaaaaaatggtta
ccggtagatttatatatcggtggtgcagaacacgctgtgcttcatttactatatgcacgt
ttctggcataaggtattgtatgatctaggcgttgtacatacgaaagaaccattccagaaa
ctattcaaccaagggatgattctcggtgaaggaaacgagaagatgagtaaatcaaaaggg
aatgtcgtgaacccggatgacgtcgttgcaagtcatggagcagatacgctacgtctctac
gaaatgttcatgggaccacttgatgcttcaatcgcatggagcacaaatggattagatggt
gcacgtcgtttcttggaccgtgtgtatcgtctgcttgtaaatgaagatggcacactctct
gagaagattacagaacaaccagtaggatctatggagaaagtgtatcatcaaactgtgaag
aaagtaacggatgactatgaaacattaggcttcaatacagcaatctcacagatgatggta
tttatcaatgaaggatacaaatctgaacaattaaacatcgaccacatccgtgggttcgta
aagttattgaatccaattgcaccacacatcacagaagaactttgggaaaaacttggcggt
acggaatcaataacgtacgaagcatggccggtatatgacgaaagtaagcttgtggacagc
gaggttgaaatcgtcattcaagtgaacggtaagcttaaacaaaaagcaacaatcgcgaaa
gatatggataaatcagaaatggaaacatttgcattatcacttgaagcagtgcagacagcg
attgaaggcaaaactgtaagaaaagtaattgctgtaccaaacaaacttgtcaatatcgtg
gcaaactag

DBGET integrated database retrieval system