KEGG   Macrococcus caseolyticus: MCCL_1630Help
Entry
MCCL_1630         CDS       T00848                                 

Definition
(GenBank) short-chain dehydrogenase/reductase family protein
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00030  Pentose phosphate pathway
mcl01100  Metabolic pathways
mcl01120  Microbial metabolism in diverse environments
mcl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MCCL_1630
Enzymes [BR:mcl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     MCCL_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase PFK Tex_YqgF DUF1776 DDE_3
Motif
Other DBs
NCBI-ProteinID: BAH18337
UniProt: B9E819
Position
1763887..1764720
Genome map
AA seq 277 aa AA seqDB search
MYLDLKGKVAIITGGASGIGRATALRYAQEGVNVVINYHSREGEAQALIEAIQSYGVEAL
MIQGDTTSKNDMEHLVQETIKHFGEFHIFVNNAGIQSDVPSHTMSIETFDKVIDVNLRGT
FIGCQLALRHFMENKYKGTIINISSVHEIIPWPHYAHYCASKGGVKLLTQSLALEYARVQ
IRVNNIAPGSINTPINAENFKTEQDKKDADLFVPMGYVAEPEEIASVAAFLASKESKYIT
GQTIVADGGLSLYPSHRNFEHDALLDEFTDEINVKPK
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgacctaaaaggtaaagtcgcaataatcactggtggtgcatcaggtatagga
cgcgctacagctttacgttacgcacaagaaggcgtcaatgttgttatcaattatcattcg
agagaaggtgaagcacaagcattaatcgaagctattcaatcatacggtgttgaggcactg
atgatccaaggagacacaaccagtaagaatgatatggaacatctcgtccaggagacgatt
aaacacttcggtgaatttcatatcttcgttaataatgcaggcatccagtccgacgttcca
agtcatacaatgtcgatagaaacattcgataaagtaatcgatgtgaatttacgtggaacc
ttcatcgggtgtcaattagccttacgtcactttatggaaaataagtataaaggtacaatc
atcaatatatcaagtgtccatgaaattataccgtggccacattatgcacattattgtgca
agtaaaggcggagtaaaattactcactcaaagtctcgctctagaatatgcacgtgtacaa
atccgcgttaataatatcgcacctggaagcatcaatacaccgatcaacgcagagaatttc
aagacggaacaagataagaaagatgcggatctatttgtaccgatgggatatgttgcagaa
cctgaagaaatcgcaagtgttgctgcatttctagcaagtaaggaaagcaagtatattacc
ggacagacgattgtagcggatggtggtctgagcctatatccatctcatcgaaactttgaa
catgatgcattgctcgatgaatttactgatgagattaatgtgaagccaaaataa

DBGET integrated database retrieval system