KEGG   Metallosphaera cuprina: Mcup_0577Help
Entry
Mcup_0577         CDS       T01467                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (NADPH)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn00010  Glycolysis / Gluconeogenesis
mcn01100  Metabolic pathways
mcn01110  Biosynthesis of secondary metabolites
mcn01120  Microbial metabolism in diverse environments
mcn01130  Biosynthesis of antibiotics
mcn01200  Carbon metabolism
mcn01230  Biosynthesis of amino acids
Module
mcn_M00002  Glycolysis, core module involving three-carbon compounds
mcn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mcup_0577
Enzymes [BR:mcn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mcup_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEB94682
UniProt: F4G0Z2
Position
525594..526616
Genome map
AA seq 340 aa AA seqDB search
MMKVSVNGYGTIGKRVASAILAQPDMSLIGVSKTSTNYEAYHAQRLGIPLYVPKESIKEF
EDAGIKVMGTIEEMFRDSDVIVDATPNGVGAQYKQVYSSLGKKSIFQGGEKANVADVSFS
ALCNYDEAVDKKYVRVVSCNTTGLLRTLCTINRVEKITKVRATIVRRAADPKEVKKGPIN
SLTPDPASIPSHHAKDVNTVLKDLDIVTMAIVAPTTLMHVHMLNITLANQVTREEVLSTL
SSTPRILLVSGKSKITSTAEIIEVARDIGRSRNDLYETVVFEDSVSVKGNELFLMYAVHQ
ESIVVPENIDAIRAVTGFRDGLKSVEMTNTSMGIRKGYLV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaggtctcagtgaacggttacggaactataggaaagagagtggcgagcgctatt
ctggctcagccagacatgagtttaatcggagtttccaaaacgtcgaccaactatgaggct
tatcacgctcaacgtttaggtatacctctatatgtaccgaaagagtctattaaggagttt
gaggacgctggcatcaaggtaatgggaactatagaggagatgtttcgtgacagtgacgtt
atagttgacgcgacgccaaacggggtaggggcccaatataagcaagtgtactcttcctta
gggaagaagtctattttccaaggaggagagaaggctaacgtagctgacgtctctttttca
gcgttatgtaactatgacgaagctgtggataagaagtacgtgagagtggtatcttgtaac
accacaggtctattgaggacattgtgtacaataaacagggtggagaagataactaaggtt
agggccacaatagttaggagagctgcggatcctaaagaggtcaagaaggggcccataaac
tctctaaccccagatccagcttccattccaagccatcacgccaaagacgtcaataccgtt
ctaaaagacctggatattgtaactatggccatagtggcacctactaccctaatgcacgtt
catatgttgaacataactttagcgaatcaagttacaagagaagaagttctatccacactt
tcgtcaacccctaggattctgctagtgtccgggaaatcgaagattacctcaactgcagaa
ataatagaggtagctagagatataggaaggagtagaaacgacctgtacgagactgtagtc
tttgaggattccgtatcagtcaaaggtaacgaactgttcttaatgtacgcggttcatcag
gagtcgattgtggttccagagaacattgatgcgatcagggcagtcacagggtttagggac
ggattgaagtcagtggagatgactaacacctcaatgggaataaggaaaggttacctggtg
taa

DBGET integrated database retrieval system