KEGG   Metallosphaera cuprina: Mcup_1586Help
Entry
Mcup_1586         CDS       T01467                                 

Definition
(GenBank) putative pyruvate: ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn00010  Glycolysis / Gluconeogenesis
mcn00020  Citrate cycle (TCA cycle)
mcn00620  Pyruvate metabolism
mcn00640  Propanoate metabolism
mcn00650  Butanoate metabolism
mcn00680  Methane metabolism
mcn00720  Carbon fixation pathways in prokaryotes
mcn01100  Metabolic pathways
mcn01120  Microbial metabolism in diverse environments
mcn01130  Biosynthesis of antibiotics
mcn01200  Carbon metabolism
Module
mcn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mcup_1586
   00020 Citrate cycle (TCA cycle)
    Mcup_1586
   00620 Pyruvate metabolism
    Mcup_1586
   00640 Propanoate metabolism
    Mcup_1586
   00650 Butanoate metabolism
    Mcup_1586
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mcup_1586
   00680 Methane metabolism
    Mcup_1586
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mcup_1586
Enzymes [BR:mcn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mcup_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N E1_dh Adeno_PX
Motif
Other DBs
NCBI-ProteinID: AEB95689
UniProt: F4FZJ9
Position
complement(1436767..1437627)
Genome map
AA seq 286 aa AA seqDB search
MNAMLRGNAACPGCPIPRELDALLEMTGEKTVLVIPASCTTVIMGDTRGMPSRVPVIHSA
FAAAPAIASGVKSALDSRGEKATVVVWAGDGGTGDIGFASLSGAAERNEDILYVCYDNEA
YMNTGVQRSGLTPYGAWTTTTPSGKRERKKPLPQLIAEHNVPYVATASIAYLFDYQAKVR
KSKDIKGFRYIHLLSPCPPGWRFDSSLTIEIAKLAVDTGIWPLYEIERGKLRLTSISKTL
IDKKKRRPVTDYLKIQGRFNNLTQDEIKFIQDSVDEMWEELAKTLP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctatgttgagaggaaacgcggcttgtccaggctgtcccattccaagggagcta
gatgcccttctggagatgacaggagaaaagaccgttctggtgataccagcttcgtgtact
acagtgataatgggcgacactagaggaatgccttctagggtgcctgtaatccatagcgct
ttcgctgcggcccccgcaatagcctccggagtaaaaagtgcattagactcaaggggagag
aaagcaactgtagtggtttgggctggagatggaggaactggtgacataggtttcgcctct
ttgagtggcgccgcagaaaggaacgaggacatactatacgtttgctatgataatgaggct
tatatgaacactggagttcagagatccggtttaactccttatggagcgtggacaactacc
accccctcagggaaaagggaaagaaagaaaccgcttccccaactcattgcagaacataac
gtaccttacgtcgccacagcgtctatagcttacctctttgactatcaagccaaagttagg
aaaagtaaagatatcaaaggttttagatacatacaccttctctcaccgtgtcctccagga
tggagatttgactcaagcctcacaattgagatcgctaagttagcagtagatacagggata
tggcctctttatgagatagagagaggaaagctaaggttaacaagcattagtaagaccctc
atagataagaagaagaggagaccggtcactgattacttaaaaatacagggtagattcaat
aatctaacacaggatgaaattaaatttattcaggacagcgtagatgagatgtgggaggag
ttggctaagacactgccttga

DBGET integrated database retrieval system