KEGG   Metallosphaera cuprina: Mcup_1888Help
Entry
Mcup_1888         CDS       T01467                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mcup_1888
Enzymes [BR:mcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mcup_1888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AEB95990
UniProt: F4G1A3
Position
complement(1719420..1720295)
Genome map
AA seq 291 aa AA seqDB search
MITVVGSYNVDMTFRVERFPVVGETVFAQEIRVGHGGKGSNQAVSCARLGASVKFVAAIG
NDVNGANALRFFREEKIDVSCVKVKNTFTGVAYILLNDKGEVMIVVNRGANNELFPEDID
DCLKGDVLLTQLEIREDVVKKALSNFHGLRILNPAPAELKDVSILNYVDILTPNEVEFKE
LSNSDDMIYAADVLLKRVRQAVIVTMGEKGSVIFTRNKSVRIPTIRVDPVDTTGAGDVFN
AALAVYLEKGYDLESAVEKANIIASISVTTYGALGPRKEEIEEKFSDISLD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgataactgttgtagggagctataacgttgacatgacgtttagggtggaacgttttcca
gtagttggcgagaccgttttcgctcaggaaattcgtgtaggtcatggaggaaagggatca
aatcaagccgtctcatgcgctagacttggagcttcggtaaagtttgttgccgctatagga
aatgatgtaaacggtgccaacgcattaagattctttcgagaggaaaagattgacgtctcc
tgtgttaaagtgaagaacacgttcacaggagtagcgtatatcttgcttaacgataaagga
gaggtcatgatagtggttaataggggagctaacaacgaattgtttcccgaggatatagat
gattgtctgaagggcgatgtgttactcactcagttggagattagagaagatgtagtcaag
aaggcattatccaactttcacggattgagaatattgaaccctgcaccggctgaactaaag
gatgtatcgatcttgaattacgttgatattcttacccctaacgaagttgagttcaaagaa
ctcagcaactcagatgatatgatttacgcagctgacgtgttacttaagagagttagacaa
gctgtcatagttacaatgggtgagaaaggatctgtgatattcactagaaacaaatcagtg
agaatccctaccattagggtagacccagttgacacaacaggagctggagatgtgtttaat
gcagctctagcggtatacctggagaaaggatacgatttagagagcgcagtggagaaagca
aatattatagcctcaatttcagttactacatatggagcgctcggacctagaaaggaagaa
atcgaagagaagttctcggacatctcactcgactaa

DBGET integrated database retrieval system