KEGG   Mesoplasma coleopterae: MCOLE_v1c03360Help
Entry
MCOLE_v1c03360    CDS       T05286                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mcol  Mesoplasma coleopterae
Pathway
mcol03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcol00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    MCOLE_v1c03360 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mcol03400]
    MCOLE_v1c03360 (recD)
Enzymes [BR:mcol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCOLE_v1c03360 (recD)
DNA repair and recombination proteins [BR:mcol03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MCOLE_v1c03360 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 SH3_13 UvrD_C_2 AAA_11 PhoH DUF2075 AAA_12 HHH_4 Helicase_RecD AAA_22 T2SSE RsgA_GTPase AAA AAA_28 Mg_chelatase NACHT AAA_5 UvrD_C NTPase_1 ABC_tran AAA_14 AAA_18 TsaE cobW AAA_16 AAA_7 AAA_29
Motif
Other DBs
NCBI-ProteinID: ATZ20850
UniProt: A0A2K8P3Z2
Position
381756..383987
Genome map
AA seq 743 aa AA seqDB search
MNEILTFRGYVVKYGFSNDAGWGTGTFASEDNLKQHMSIKGSITSMDKKTLYEITGYFEE
HPRYGKSFNVQTYRKAPIHSTKEQVKFLAGPAFPGVGDKTAEIIINHLGDKAITKLVKDI
NLLNEIPGLNPIYIPIIKKGIEENIRQEGQERLRYIFFENNLKTSILDWMDNHFDQDNDI
IENIFSNSFLSFAKDKEIASFDELDKVAVHFGLELHSPERIAYWAWKLADDFLFASGDSY
TNKDYLSRSLMRKLKIQDTELLFEGILYAKEKGILKLTKNRIYTEESWREEQIIADNIIK
LNIPTKNVNKEGISWEIDQIEQEIAYENKIKDFKFDEKQREALELFANNKLSIITGGPGT
GKTTLIKGIVKLFNRMSGTEDYAIATPTGRAAARIRETYKKSYATTIHKLLEAKELNKFQ
ITQNNPLNQKLVILDECSMIDNKLFASFIQSCDRVRKVVLVGDANQLPSVGYGNTFADLL
ELDFLKTIKLDTVHRQKNGNGIVDLAYKVLNETLEISDLESMSNVEINFDYNNQNTMNKV
TELVGQHWDELEKKANHLQVICPMYGGSLGIDEINAQIQNEFNENVKDKKKVYDRGDYRF
VVDDKIMFLKNDTDLDLANGDVGKIIKINYNAIGKLKDVLTEFNDKEILLQPKNFSDVKL
SYATSVHKTQGSEYNNVLLVIDNPKYNSGFINKTLIYTAVTRAKDKIVILGDSDLFFNAI
KITPPRRNTTLIEAILEKREING
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaatattaacttttagagggtatgttgttaaatatggtttttcaaacgatgct
gggtgaggaactggtacatttgcaagtgaagataatttaaaacagcatatgagcattaaa
ggctcaataactagtatggataaaaaaactttatatgaaataactggttattttgaagaa
catccacgttatggtaaaagtttcaacgttcaaacttatcgaaaagcacccattcattca
actaaagaacaagttaaatttttagcaggtccagcatttcctggagtaggagataaaaca
gctgaaatcataataaatcatttaggtgataaagctattactaagttagtaaaagatatt
aatttattaaatgaaatacctggtttaaatccaatttatattccaattattaaaaaaggt
attgaagaaaacattagacaagaagggcaagaaagattaagatacatcttttttgaaaac
aatcttaaaacttcaattcttgattgaatggataatcactttgatcaagataatgatatt
attgaaaatattttttcaaattcatttttatcatttgcaaaagacaaagaaatagcttca
tttgatgaactagataaagttgctgttcattttggcttagaattacattcaccagaaaga
attgcatattgagcatgaaagttagcagatgatttcttatttgcttctggagatagttat
acaaataaggattacttatcaagaagtttaatgcgtaagttaaaaatacaagatacagaa
cttttatttgaaggtattttatacgctaaagaaaaaggtattttaaaattaactaaaaat
cgtatctacacagaagaatcatgaagagaagaacaaattatcgcagataacataattaag
cttaatatacccactaaaaacgtgaataaagagggtatatcatgagaaatagatcaaata
gaacaagaaattgcttatgagaataaaattaaagattttaagtttgatgaaaaacaaaga
gaagccttagagttatttgctaataataaactttcaattattactggaggaccagggaca
gggaaaacaactttaattaaaggaatagttaagttatttaatcgtatgagtggaactgaa
gattatgcaatagccactccaactggaagagcagcagcaagaatcagagaaacatacaaa
aaatcatatgctacaactattcataaattactagaagctaaagaattaaataaatttcaa
attacacaaaacaatcctttaaatcaaaaattagtaattttggatgaatgttcaatgatt
gataataagttatttgcaagtttcattcaatcatgtgatcgtgttagaaaagttgtatta
gtaggagatgctaatcaattgccaagtgtaggttatggaaatacttttgctgatttattg
gaattagattttttaaaaacaattaaattagatacagtgcatagacaaaaaaatggaaat
gggatagttgatttagcatataaagttttaaatgagacattagaaataagcgatttagaa
tctatgagcaatgttgaaattaattttgactacaataatcaaaatacaatgaataaagta
actgagttggtaggtcaacattgagatgaattagagaaaaaagctaaccacttacaagtg
atatgtccaatgtatggtggtagtttaggaattgatgaaattaatgcgcaaattcaaaat
gaatttaacgagaatgttaaagataaaaagaaagtatatgatcgaggagattatcgattc
gtagttgatgataagattatgttcttgaaaaatgatactgatttagatttagctaatggt
gatgttggaaagattattaaaataaactataacgcaattggtaagttaaaagatgtttta
acagaatttaatgataaagaaatattattacaacctaaaaactttagtgatgtaaaatta
tcttatgcaactagtgtgcataagactcaaggtagtgaatataataatgttttattagtc
attgataatcccaaatataattcgggttttattaataaaacattgatatatactgctgta
acaagagccaaagataaaattgtaattttaggtgatagtgatttattctttaatgcaatt
aaaataactccaccaagaagaaatacaactttaattgaagcaattttagaaaagagagaa
ataaatgggtaa

DBGET integrated database retrieval system