KEGG   Mycoplasma capricolum subsp. capricolum ATCC 27343: MCAP_0220Help
Entry
MCAP_0220         CDS       T00309                                 

Gene name
pfkA
Definition
(GenBank) Phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcp  Mycoplasma capricolum subsp. capricolum ATCC 27343
Pathway
mcp00010  Glycolysis / Gluconeogenesis
mcp00030  Pentose phosphate pathway
mcp00051  Fructose and mannose metabolism
mcp00052  Galactose metabolism
mcp00680  Methane metabolism
mcp01100  Metabolic pathways
mcp01110  Biosynthesis of secondary metabolites
mcp01120  Microbial metabolism in diverse environments
mcp01130  Biosynthesis of antibiotics
mcp01200  Carbon metabolism
mcp01230  Biosynthesis of amino acids
mcp03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mcp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCAP_0220 (pfkA)
   00030 Pentose phosphate pathway
    MCAP_0220 (pfkA)
   00051 Fructose and mannose metabolism
    MCAP_0220 (pfkA)
   00052 Galactose metabolism
    MCAP_0220 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MCAP_0220 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MCAP_0220 (pfkA)
Enzymes [BR:mcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MCAP_0220 (pfkA)
Protein phosphatases and associated proteins [BR:mcp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MCAP_0220 (pfkA)
Messenger RNA biogenesis [BR:mcp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MCAP_0220 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DUF1515
Motif
Other DBs
NCBI-ProteinID: ABC01496
UniProt: Q2SSQ6
Position
264143..265123
Genome map
AA seq 326 aa AA seqDB search
MIKKIGILTSGGDAPGMNNAIAGVVKTASSKGIEVYGINDGYKGLVNGWFEKLNVEKTLD
ILSRGGTYLGSARLPEFKELEVRQKAVANLKKAGIEALVVIGGDGSYMGAQRLTEMGINC
IGLPGTIDNDIASTDYTIGFHTALNTIVEAVDRIRDTMQSHNRADVVEIMGNGCGDLVTY
TAVATGAEIFSPAEDLLTIEQMGQKAKQFRLLGKKSLIILVSEKLYGISAEEIAEKIQKI
SGYETKATVLGHIQRGGRPTAMDRYIAFTAGMFAVEKLAEGKGGLFIGLENNKLVARDID
STLNMKKEDKKPFIKNLREINGHFSK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaatcggaattttaacttctggtggtgatgctcctggaatgaataatgcc
attgctggagttgtaaaaacagcttcttcaaaaggtattgaagtatatgggattaatgat
ggatataaaggattagtaaatggttgatttgaaaaactaaatgttgaaaaaactttagat
attctttcaaggggtggaacttatttaggttcagcaagactacctgaatttaaagaatta
gaagtaagacaaaaagctgtagcaaatcttaaaaaggctggaattgaagctttagttgta
attggtggagatggtagttatatgggtgctcaaagattaactgaaatgggtattaattgt
atagggctacctggaactattgataatgatattgcttcaactgattatactattggtttt
catactgcactaaatacaattgttgaagcagttgatagaattagagatacaatgcaatca
cataatagagcagatgttgttgaaattatgggaaatggttgcggtgatttggtaacttat
acagcagttgctacaggagctgagatattttctccagctgaagatttattaacaattgaa
caaatgggtcaaaaagcaaaacaatttagattattaggtaaaaaaagtttaattatttta
gtttcagaaaagttatatggaatatctgctgaagaaattgctgaaaagattcaaaaaatt
agtggttatgaaactaaagcaactgttttaggacatattcaacgtggtggtagaccaact
gctatggatagatatatagcttttacagctggtatgtttgctgttgaaaaactagctgaa
ggtaaaggtggattatttataggattagaaaataataaactagttgcaagagatattgat
tcaactttaaatatgaaaaaagaagataaaaaaccttttattaaaaatttaagagaaatt
aatggacattttagcaaataa

DBGET integrated database retrieval system