KEGG   Mycobacterium canettii CIPT 140060008: BN44_10164Help
Entry
BN44_10164        CDS       T02419                                 

Gene name
cyp
Definition
(GenBank) Putative cytochrome P450 138 cyp138
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: CCK50053
Position
168937..170262
Genome map
AA seq 441 aa AA seqDB search
MSEVVTAAPAPPVVRLPPAVRGPKLFQGLAFVVSRRRLLGRFVRRYGKAFTANILMYGRV
VVVADPQLARQVFTSSPEELGNIQPNLSRMFGSGSVFALDGDDHRRRRRLLAPPFHGKSM
KNYETIIEEETLRETANWPQGQAFATLPSMMHITLNAILRAIFGAGGSELDELRRLIPPW
VTLGSRLAALPKPKRDYGRLSPWGRLAEWRRQYDTVIDKLIEAERADPNFADRTDVLALM
LRSTYDDGSIMSRKDIGDELLTLLAAGHETTAATLGWAFERLSRHPDVLAALVEEVDNGG
HELRQAAILEVQRARTVIDFAARRVNPPVYQLGEWVIPRGYSIIINIAQIHGDPDVFPQP
DRFDPQRYIGSKPSPFAWIPFGGGTRRCVGAAFANMEMDVVLRTVLRHFTLETTTAAGER
SHGRGVAFTPKDGGRVVMRRR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagtcgtcaccgccgcaccggcaccgcccgtagtccgacttcccccggcggtc
cgcgggccgaagttgttccagggattggccttcgtggtgtcacggcgacggctgctgggg
cggttcgtgcgtcgctacggcaaggccttcaccgccaatatcctgatgtacggccgggtc
gtggtggtcgccgacccgcagctagccaggcaggtcttcaccagcagtcctgaggagctg
ggcaacatccagcccaacctgagtcggatgttcggttccggctcggtgttcgcgctggac
ggcgacgaccaccggcggcggcgccggctactggcgccgcctttccacggcaagagcatg
aagaactacgagaccatcatcgaagaggagaccctgcgcgagaccgccaattggccgcaa
ggccaggctttcgcaacgctgccgtcaatgatgcatatcacgctcaacgccatcctgcgt
gcgatcttcggggccggcggcagtgaactagacgagctgcgccgcctcattccgccgtgg
gtcacgctgggctcgcgcctggccgcgctaccgaaacccaaacgcgactatggccgcctt
agcccgtggggccggctggccgagtggcggcgccagtacgacactgtcatcgacaagctc
atcgaagccgagcgggccgacccgaacttcgccgatcggaccgacgtattggcgttgatg
ctgcgcagcacttacgacgacggttccatcatgtcgcgcaaggacattggcgacgagctg
ctcacgctgctggccgccgggcacgaaaccacggcggcgacactgggctgggcgttcgag
cggctcagccggcaccccgacgtgctcgcggctctggtcgaggaggtcgacaacggcggt
cacgagctgcgtcaagcggcgatcctggaggtacagcgggccaggaccgtcatcgatttt
gcggctcgtcgcgtcaatccacccgtttaccagctcggcgagtgggtgattccccgcggg
tattcgatcattatcaatatcgcccagatacatggcgatcccgacgtcttcccgcagccg
gatcgcttcgacccgcagcgctacatcggaagtaagccatccccgtttgcgtggatccct
tttggtggcgggacccgccgctgtgtcggggccgcattcgccaacatggagatggatgtg
gtgctgcgaacggtgctgcgccacttcaccctcgagaccaccacggccgcgggcgagcgc
agccacggtcgaggagttgcattcaccccgaaggatggcggtcgggtggtgatgcgccga
cgctga

DBGET integrated database retrieval system