KEGG   Mycobacterium canettii CIPT 140060008: BN44_10171Help
Entry
BN44_10171        CDS       T02419                                 

Definition
(GenBank) Putative ion channel involved in transport of chloride across the membrane
  KO
K03281  chloride channel protein, CIC family
Organism
mcq  Mycobacterium canettii CIPT 140060008
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BN44_10171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Voltage_CLC
Motif
Other DBs
NCBI-ProteinID: CCK50060
Position
complement(174275..175732)
Genome map
AA seq 485 aa AA seqDB search
MFAWHAANLPTMPEAEDIGNEAAGGRFGVSIRSAGYLRKWFLLGITIGVIAGLGAVVFYL
ALKYTSEFLLGYLADYQIPTPVGEGGHRGSTGFARPWAIPLVTTGGAVLSALIVAKLAPE
ATGHGTDEAIESVHGDPRAIRGRAVLVKMVASALTIGSGGSGGREGPTAQISAGFCSLLT
RRLNLSNEDGRTAVALGIGAGIGAIFAAPLGGAALGASIPYRDDFDYRNLLPGFIASGTA
YAVLGAFLGFDPLFGYIDAEYRFEKAWPLLWFVVIGLIAAAVGYLYARVFHASVAITRRL
PGGPVLKPAIGGLLVGLLGLPIPQILSSGYGWAQLAADRGTLLSIPLWIVIVLPIAKILA
TSLSIGTGGSGGLFGPGIVIGAFVGAAIWRLGELTELPGVPHEPGIFVVVAMMACFGSVS
RAPLAVMIMVAEMTGSFSVVPGAIIAVGIAALLLSRTNVTIYETQRLNRQTAEAERGGSD
RPTTA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgcttggcatgctgctaacctcccgaccatgccggaggcggaagacatcgggaac
gaggccgccggcggacgattcggcgtatcgatcaggagcgcgggctacctgcgcaaatgg
ttcctgctaggcatcacgatcggtgtcattgccggcctgggcgccgtcgtcttctacctc
gcgctgaaatacaccagcgagtttctgctcggctacctcgcggactatcagattcccact
cccgttggggagggcggccaccgcgggtccaccggtttcgcgcgtccgtgggcgattccg
ctggtgacgacgggcggggcggtgctgtcggcattgatcgtggccaagctcgccccggag
gccaccggtcacggcaccgacgaagcgatcgagtcggtgcacggcgatccgcgcgccatc
cgaggtcgggcggtgctggtgaagatggtggccagcgccttgaccatcggctcgggcggt
tcaggcggccgcgaaggcccgaccgcgcagatctcggccggcttctgctcactgctgacc
cgccggctgaacctgtccaacgaagacggccggaccgcggtagcgctgggtatcggcgcc
ggcatcggcgccatcttcgctgcgccactgggcggagcggcgttgggcgcctcgatcccc
taccgcgacgacttcgactaccgcaacctgctgccgggtttcatcgcctcgggaaccgcc
tacgccgtgctcggcgccttcttgggcttcgacccgctgttcggctacatcgacgccgag
tatcgcttcgaaaaggcgtggccactactgtggttcgtggtgatcgggctgattgcagcc
gccgtaggctacttgtatgcccgagtctttcacgcgtcggtggcaattacgcgccggctg
cccgggggcccggtgctcaaaccggcgatcggcggactgctggtcgggctgttaggtctg
ccgattccccagatcctgagcagcggctatggctgggcgcagctagccgccgatcggggg
acgctgctgagcatcccgttgtggatcgtcatcgtcttgccgatcgccaagatcctcgcg
acgtcgctgtcgatcggcaccggcggatcaggcgggctattcgggccgggaatcgtgatc
ggcgccttcgtcggagcggcgatctggcggctaggcgagctcaccgagctgcccggggtt
ccccacgagccgggcatcttcgtcgtggtcgcaatgatggcgtgcttcggcagtgtctcc
cgcgcgccgctggccgtcatgatcatggtcgctgagatgaccggctcgttctcggtggtg
cctggagcgatcatcgccgtcggtatcgcggcactgttgttgtctcgcaccaacgtcacc
atctacgagacgcagcgactgaaccggcagaccgccgaggccgaacgcggaggcagtgat
cggccgacaacggcttag

DBGET integrated database retrieval system