KEGG   Mycobacterium canettii CIPT 140060008: BN44_10173Help
Entry
BN44_10173        CDS       T02419                                 

Definition
(GenBank) Putative TetR family transcriptional regulator
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_11 TetR_C_6 Gag_p30 Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: CCK50061
Position
175908..176702
Genome map
AA seq 264 aa AA seqDB search
MAAFRPVGHYRLATDRAGWPCSPPATGAKLTSSVASRPTVGTKPQWWHTLVMSMSLTAGR
GPGRPPAAKADETRKRILHAARQVFSERGYDGATFQEIAVRADLTRPAINHYFANKRVLY
QEVVEQTHELVIVAGIERARREPTLMGRLAVVVDFAMEADAQYPASTAFLATTVLESQRH
PELSRTENDAVRATREFLVWAVNDAIERGELAADVDVSSLAETLLVVLCGVGFYIGFVGS
YQRMATITDSFQQLLAGTLWRPPT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgttcaggccggtcggccattaccgactcgcaacggacagagccggttggccc
tgctcgcccccggcgaccggagccaagctgacaagttccgtagcatcccgcccaacggta
ggtaccaagccgcagtggtggcacactttagtgatgtcaatgtcgctcacggccggtcgc
ggcccgggacgtcccccggcggcgaaagcagatgagactcggaagcgtattctgcacgcc
gcccgtcaagtgttcagcgaacgtggttatgacggcgcgacttttcaggagatcgccgtc
cgcgccgacctgacccgaccggcgatcaaccactacttcgccaacaagcgggtgctctac
caagaggtggtggagcaaacccacgaactcgtcattgtggccggcatcgaacgggcacgc
cgcgagccgaccttgatggggcggctggcggtcgtcgttgacttcgcgatggaggccgat
gcccagtatcccgcctcgaccgcgttcctggccaccaccgtgctcgaatcccagcggcat
ccagaattgagtcggaccgaaaacgatgcggtgcgagcaacccgagaattcctggtttgg
gctgtcaatgatgcgatcgaacgcggtgaactagccgccgacgtcgatgtctcttcgttg
gccgagacgctgttggtcgtgttgtgtggcgtgggcttctatatcggttttgtcgggagc
tatcagcggatggcgaccatcaccgattcgttccagcagctgttggccggcacgctctgg
cggcctccgacctga

DBGET integrated database retrieval system