KEGG   Mycobacterium canettii CIPT 140060008: BN44_10177Help
Entry
BN44_10177        CDS       T02419                                 

Definition
(GenBank) Putative short-chain type dehydrogenase/reductase
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-ProteinID: CCK50065
Position
180409..181269
Genome map
AA seq 286 aa AA seqDB search
MPGVQDRVIVVTGAGGGLGREYALTLAGEGASVVVNDLGGARDGTGAGSAMADEVVAEIR
DKGGRAVANYDSVATEDGAANIIKTALDEFGAVHGVVSNAGILRDGTFHKMSFENWDAVL
KVHLYGGYHVLRAAWPHFREQSYGRVVVATSTSGLFGNFGQTNYGAAKLGLVGLINTLAL
EGAKYNIHANALAPIAATRMTQDILPPEVLEKLTPEFVAPVVAYLCTEECADNASVYVVG
GGKVQRVALFGNDGANFDKPPSVQDVAARWAEITDLSGAKIAGFKL
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcccggagtgcaagatcgcgtcatcgtcgttactggagccggcggtggcttgggccgc
gaatacgcccttacgctcgccggggagggcgccagcgtcgtggtcaacgacctcggtggc
gcccgcgacggcacgggcgccggttcggcgatggccgatgaggtcgtcgccgagattcgc
gacaaggggggccgggcggtcgccaactacgacagcgtcgccaccgaggacggcgcagcg
aacatcatcaagaccgcgcttgacgaattcggcgccgtgcacggtgtggtgagcaacgcc
gggatcttgcgcgacggcaccttccacaagatgtcgttcgagaattgggacgccgtgctt
aaggtgcacctttatggcggataccacgtgctacgcgcggcctggccgcatttccgtgag
cagagttacggccgggtcgtggtggcgacctccaccagcgggctgttcggcaacttcggc
cagaccaactatggggcggccaagcttggtctggtcggcctgatcaatacgctggcgctg
gagggagccaagtacaacatccacgccaatgctcttgccccgatcgcggcgaccaggatg
acccaggacatcctgccgcccgaagtactggaaaagctcacacccgagttcgtcgcaccg
gtggtggcctacctgtgcaccgaggagtgtgccgacaacgcatcggtgtacgtcgtcggt
ggtggcaaggtgcagcgagttgcgctgtttggcaacgacggcgccaacttcgacaaaccg
ccgtcggtacaagatgttgcggcgcggtgggccgagatcaccgatctgtccggtgcgaaa
attgctggattcaagttgtag

DBGET integrated database retrieval system