KEGG   Mycobacterium canettii CIPT 140060008: BN44_10183Help
Entry
BN44_10183        CDS       T02419                                 

Gene name
fadE
Definition
(GenBank) Acyl-CoA dehydrogenase FadE2
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00071  Fatty acid degradation
mcq00280  Valine, leucine and isoleucine degradation
mcq00410  beta-Alanine metabolism
mcq00640  Propanoate metabolism
mcq01100  Metabolic pathways
mcq01110  Biosynthesis of secondary metabolites
mcq01130  Biosynthesis of antibiotics
mcq01200  Carbon metabolism
mcq01212  Fatty acid metabolism
Module
mcq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BN44_10183 (fadE)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN44_10183 (fadE)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN44_10183 (fadE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN44_10183 (fadE)
Enzymes [BR:mcq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     BN44_10183 (fadE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_dh_N DUF4169
Motif
Other DBs
NCBI-ProteinID: CCK50071
Position
complement(187553..188764)
Genome map
AA seq 403 aa AA seqDB search
MSAMAIDYRTRLSDFMTEYVFPAEADYDDYRRTAGPADHTVPPIIEELKTKAKDRGLWNL
FLPAESGLTNLEYAPLAEMTGWSMEIAPEALNCAAPDTGNMEILHMFGTEQQRAQWLRPL
LDGKIRSAFSMTEPAVASSDARNIETTISRDGADYVINGRKWWTSGAADPRCKILIVMGR
TNPDAATHQQQSMVLVPIDTPGVTIVRSTPVFGWQDRHGHCEIDYHNVRIPATNLLGEEG
SGFAIAQARLGPGRIHHCMRALGAAERALALMVNRVRNRVAFGRPLAEQGVVQQAIAQSR
NEIDQARLLCEKAAWTIDQHGNKEARHLVAMIKAVAPRVACDVIDRAIQVHGAAGVSDDT
PLARLYGWHRAMRIFDGPDEVHLRSIARAELSREKSTFAAAVT
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccatggccatcgactaccgcacgcggttgtccgacttcatgaccgagtacgtg
tttccggctgaggccgattacgacgactatcgccgcacggccggaccggccgaccatacc
gtgccgccgatcatcgaggaactgaaaaccaaggccaaagaccgcggcctgtggaaccta
ttcctgccggccgagtcgggattgaccaacctggagtacgcgccgctggccgaaatgacc
ggatggagcatggaaatcgcgcccgaggcactcaactgcgccgcgccggacaccggcaac
atggagatcctgcacatgttcggcaccgagcagcaacgggcgcaatggctgcggccgctg
ctcgacggcaagatccgcagcgccttctcgatgaccgagccggcggtggccagcagcgac
gcccgcaacatcgaaaccaccatctcccgggacggtgccgactacgtcatcaacggccgt
aaatggtggacgtcgggagcggcggacccgcgctgcaagatcctcatcgtgatgggccgc
accaacccggacgcggccacccaccaacagcagtcgatggtcctcgtcccgatcgacacc
cccggggtgacgatcgttcgctccacaccggtgttcggctggcaggaccggcacggccac
tgcgagatcgactaccacaacgtccggatcccggccaccaacctgctcggcgaagagggc
agcggcttcgccatagcccaggcccggctgggaccgggccgtatccaccactgcatgcgt
gcgctgggcgcggccgaacgcgcgttggcgctcatggtgaatcgggtccgcaaccgggtg
gcgttcggccgtccgctggccgaacagggcgtcgtgcaacaggcgattgctcagtcccgc
aacgaaatcgaccaggccaggctgctgtgcgaaaaggcggcgtggacaatcgaccaacac
ggcaacaaagaggcgcgccacctggtcgccatgatcaaggcggtggccccgcgggtggcc
tgcgatgttatcgaccgcgcaatccaggtccacggggccgccggtgtcagcgacgacacc
ccgctggcccggctgtacggctggcaccgcgccatgcgcatctttgacggtcccgacgag
gtgcacctgcgctccatcgcccgcgccgagctgtcgcgggagaagtccacctttgccgcg
gcggtcacctga

DBGET integrated database retrieval system