KEGG   Mycobacterium canettii CIPT 140060008: BN44_10184Help
Entry
BN44_10184        CDS       T02419                                 

Definition
(GenBank) Putative response regulator receiver domain-containing protein
  KO
K09958  uncharacterized protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BN44_10184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1348
Motif
Other DBs
NCBI-ProteinID: CCK50072
Position
188929..189135
Genome map
AA seq 68 aa AA seqDB search
MWSFHDNRIAVRFQYESRDRNGQWYRSYGTELWRSQHQRRADRRIRASLLRCALGIRVWP
GNTALVAR
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
ttgtggagcttccacgacaaccgcattgcggtgcggttccagtacgaatcccgtgaccgc
aacggccagtggtatcgcagctacggcaccgaactgtggcgaagccagcatcaacgacgt
gccgatcgccgaatccgagcgtcgctacttcggtgcgcgctcggcatccgagtatggcca
ggaaataccgctctggtagcccggtag

DBGET integrated database retrieval system