KEGG   Mycobacterium canettii CIPT 140060008: BN44_10190Help
Entry
BN44_10190        CDS       T02419                                 

Definition
(GenBank) Putative transcriptional regulatory protein (possibly TetR-family)
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_5 HTH_Tnp_1_2
Motif
Other DBs
NCBI-ProteinID: CCK50076
Position
192351..192995
Genome map
AA seq 214 aa AA seqDB search
MPSDTSPNGLSRREELLAVATKLFAARGYHGTRMDDVADVIGLNKATVYHYYASKSLILF
DIYRQAAEGTLAAVHDDPSWTAREALYQYTVRLLTAIASNPERAAVYFQEQPYITEWFTS
EQVAEVREKEQQVYEHVHGLIDRGIASGEFYECDSHVVALGYIGMTLGSYRWLRPSGRRT
AKEIAAEFSTALLRGLIRDESIRNQSPLGTRKET
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgccatccgacaccagccccaacgggctaagccgccgtgaggagttgctggctgttgcc
accaaactattcgcggcgcgcggttatcacggcacccggatggacgacgtcgccgatgtg
atcgggctcaacaaagcaacggtctatcactactacgccagcaagtcgctgatcctgttc
gacatttaccgtcaggcggccgagggcaccctggccgccgtgcacgacgatccgtcctgg
acggcccgtgaagcgctgtaccagtacacggtccggctgctcactgccatcgcgagcaac
cccgagcgggccgcggtgtacttccaggagcagccctacatcaccgagtggttcaccagc
gagcaggtcgccgaggtccgcgagaaggagcagcaagtctacgagcacgtacacggcctg
atcgaccgcgggattgccagcggcgagttctatgagtgcgactcgcatgtggtggcgctg
gggtacatcgggatgacgctgggcagctaccgctggctgcggccgagcgggcgccgaacg
gccaaggagatcgcggcggagttcagcacggcactgttgcgcgggctgatccgcgacgaa
tcgatccgcaaccagtctccgcttggaactcggaaggaaacgtga

DBGET integrated database retrieval system