KEGG   Mycobacterium canettii CIPT 140060008: BN44_10191Help
Entry
BN44_10191        CDS       T02419                                 

Gene name
PE
Definition
(GenBank) Conserved protein of unknown function, PE family
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PE-PPE PE
Motif
Other DBs
NCBI-ProteinID: CCK50077
Position
complement(192999..194405)
Genome map
AA seq 468 aa AA seqDB search
MSYVIAAPEMLATAAADVDGIGSAIRAASASAAGPTTGLLAAAADEVSSAAAALFSEYAR
ECQEVLKQAAAFHGEFTRALAAAGAAYAQAEASNTAAMSGTAGSSGALGSVGMLSGNPLT
ALMMGGTGEPILSDRVLAIIDSAYIRPIFGPNNPVAQYTPEQWWPFIGNLSLDQSIAQGV
TLLNNGINAELQNGHDVVVFGYSQSAAVATNEIRALMALPPGQAPDPSRLAFTLIGNINN
PNGGVLERYVGLYLPFLDMSFNGATPPNSPYQTYMYTGQYDGYAHNPQYPLNILSDLNAF
MGIRWVHNAYPFTAAEVANAVPLPTSPGYTGNTHYYMFLTQDLPLLQPIRAIPFVGTPIA
ELIQPDLRVLVDLGYGYGYADVPTPASLFAPINPIAVASALATGTVQGPQAALVSIGLLP
QSALPNTYPYLPSANPGLMINFGQSSVTELSVLSGALGSVARLIPPIA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgtcatcgcggccccggagatgttggcaacggcggccgcggacgtggacggg
atcggttcggcgatccgagcggccagcgcgtccgctgcgggtccaacgaccggactgctg
gccgcggccgccgatgaggtgtcgtcggcagctgcagcgctgttcagcgaatacgcgcgc
gaatgtcaagaggtcctaaagcaggctgcggcgttccatggcgagttcacccgggcgctg
gctgccgccggagccgcctacgcccaggctgaagccagcaacaccgctgctatgtcgggc
accgccgggtccagcggcgccctcggttctgtcgggatgctgtcaggcaacccgctaacc
gcgttgatgatgggcggcaccggggaaccgatccttagtgaccgcgtcttggcgatcatt
gacagcgcatacattcggcccattttcgggcccaacaacccggtcgcccagtacacgccc
gagcagtggtggccgtttatcgggaacctgtcactggaccagtccatcgcccagggtgtc
acgctgctgaacaacggcatcaacgcggaactacaaaatgggcatgacgtcgtcgttttc
ggctactcgcaaagcgccgcggtagccaccaatgaaatacgcgctcttatggcgttacca
ccgggccaagccccagatccaagccggctggctttcacgttgatcggtaatatcaataac
cccaacggcggcgtcctcgagcgttacgtgggcctttacctcccgttcttggatatgtcg
ttcaacggtgcgactccaccgaattccccctaccagacctacatgtacaccggccaatac
gacggctacgcccacaacccgcagtacccgctcaatatcttgtcggacctcaacgccttc
atgggcatcagatgggtgcacaacgcgtaccccttcaccgcggccgaggttgccaatgcc
gtgccgttgcccacgtctccgggctacaccggcaacacccattactacatgtttctgacc
caggacctgccgctgttgcagccgattcgcgccatccccttcgtagggaccccaatagcc
gagctgattcagcccgacctacgggtgctagtcgacttgggctatggctacggctacgcc
gacgtacccaccccggccagcctgttcgcgccaatcaacccgatcgcggtggcctcggcc
ctggcgaccgggaccgtgcaaggcccccaagccgccctagtaagcatcggattgttaccg
cagtccgcgctacccaatacgtatccgtatcttccgtcggcgaatccgggcctgatgatc
aacttcggtcaatccagtgtgacggagttgtcggtgctcagtggcgccctcgggtccgta
gcgagattgattccaccgatcgcgtga

DBGET integrated database retrieval system