KEGG   Mycobacterium canettii CIPT 140060008: BN44_10215Help
Entry
BN44_10215        CDS       T02419                                 

Gene name
sigG
Definition
(GenBank) Putative alternative RNA polymerase Sigma factor SigG (RNA polymerase ECF type Sigma factor)
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
mcq  Mycobacterium canettii CIPT 140060008
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mcq03021]
    BN44_10215 (sigG)
Transcription machinery [BR:mcq03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BN44_10215 (sigG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 SnoaL_2 Sigma70_r4 SnoaL_4 NTF2 Acetyltransf_6
Motif
Other DBs
NCBI-ProteinID: CCK50100
Position
complement(218651..219763)
Genome map
AA seq 370 aa AA seqDB search
MRTSPMPAKFRSVRVVVITGSVTAAPVRVSETLRRLIDVSVLAENSGREPADERRGDFSA
HTEPYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYEGFAGKSSLRTWLHRIATNTCL
TALEGRRRRPLPTGLERPSADPSGELVERREVSWLEPLPDVTDDPADPSTIVGNRESVRL
AFVAALQHLSPRQRAVLLLRDVLQWKSAEVADAIGTSTVAVNSLLQRARSQLQTVRPSAA
DRLSAPDSPEAQDLLARYIAAFEAYDIDRLVELFTAEAIWEMPPYIGWYQGAQAIVTLIH
QQCPADSPGDMRLISLIANGQPAAAMYMRAGDVHLPFQLHVLDMAADRVSHVVAFLDTTL
FPKFGLPDSL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacatcgccgatgcccgcgaaattccgttcagtccgggtggtagtcattaccggg
agcgtaacggctgctccggtgagagtgtcggagactctgcgtaggctcattgacgtgagt
gtgctcgcagaaaactctggccgcgagcccgccgacgaacggcgcggggacttctccgcc
cataccgagccctaccggcgtgaactgctcgcacactgctatcgcatgactggctcgctg
cacgacgcggaagaccttgttcaggagacgctgctgcgggcctggaaggcctatgagggc
ttcgcgggcaagtcctcgctacgcacctggctgcatcggatcgccaccaacacctgcctg
acggcgttggagggccgtcgacgccggccgttgccgacggggctcgagcggccgagtgcc
gatccgtccggggagttggtggaacgtcgagaggtgtcctggctggagccgctgccggac
gtgacggatgaccctgctgatccctcaacgatcgtcgggaaccgggaatcggtgcggttg
gcctttgtggcggctctgcagcacctctcaccccggcagcgagccgtactgctgctgcgc
gacgtgctgcagtggaaatcggccgaggtggccgacgcgatcggtaccagcaccgtcgcc
gtcaatagcctgctgcagcgggcccgctctcagctgcagacggtccggcccagcgccgcc
gaccggttgtccgcgccggattcacccgaggcgcaagacctgttggcccgctacatcgcc
gcgttcgaggcttatgacatcgaccggttggtcgagctgttcaccgccgaggcgatctgg
gaaatgccgccgtatatcggctggtaccagggcgcacaggccatcgtcaccctcattcac
caacagtgccccgccgattcgcctggcgatatgcgcctgatttcgttgatcgccaacggc
cagcccgccgcggccatgtacatgcgtgccggtgacgtgcacctgccttttcagctacac
gtgctggacatggccgccgaccgcgtgtcacacgtggtggccttcctcgacaccaccttg
ttcccgaaattcggcctgcccgattcgctgtga

DBGET integrated database retrieval system