KEGG   Mycobacterium canettii CIPT 140060008: BN44_10222Help
Entry
BN44_10222        CDS       T02419                                 

Gene name
ilvD
Definition
(GenBank) Putative dihydroxy-acid dehydratase IlvD (DAD)
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00290  Valine, leucine and isoleucine biosynthesis
mcq00770  Pantothenate and CoA biosynthesis
mcq01100  Metabolic pathways
mcq01110  Biosynthesis of secondary metabolites
mcq01130  Biosynthesis of antibiotics
mcq01210  2-Oxocarboxylic acid metabolism
mcq01230  Biosynthesis of amino acids
Module
mcq_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mcq_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BN44_10222 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BN44_10222 (ilvD)
Enzymes [BR:mcq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     BN44_10222 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: CCK50107
Position
complement(225619..227346)
Genome map
AA seq 575 aa AA seqDB search
MPQTTDEAASVSTVADIKPRSRDVTDGLEKAAARGMLRAVGMDDEDFAKPQIGVASSWNE
ITPCNLSLDRLANAVKEGVFSAGGYPLEFGTISVSDGISMGHEGMHFSLVSREVIADSVE
VVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAAVFLYAGSILPGRAKLSDGSERDVTI
IDAFEAVGACSRGLMSRADVDAIERAICPGEGACGGMYTANTMASAAEALGMSLPGSAAP
PATDRRRDGFARRSGQAVVELLRRGITARDILTKEAFENAIAVVMAFGGSTNAVLHLLAI
AHEANVALSLQDFSRIGSGVPHLADVKPFGRHVMSDVDHIGGVPVVMKALLDAGLLHGDC
LTVTGHTMAENLAAITPPDPDGKVLRALANPIHPSGGITILHGSLAPEGAVVKTAGFDSD
VFEGTARVFDGERAALDALEDGTITVGDAVVIRYEGPKGGPGMREMLAITGAIKGAGLGK
DVLLLTDGRFSGGTTGLCVGHIAPEAVDGGPIALLRNGDRIRLDVAGRVLDVLADPAEFV
SRQQDFSPPPPRYTTGVLAKYVKLVSSAAVGAVCG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaaaccaccgacgaagccgcttccgtctcgacggtcgccgacatcaagccccgc
agtcgagacgtcaccgacggcctggagaaggccgctgcccggggcatgttgagggcggtg
ggcatggacgacgaagacttcgcgaagccacagatcggggtcgcatcgtcgtggaacgaa
atcacgccgtgcaatctctcattggaccggctggccaacgcggtcaaggagggggtgttt
tcggccggcggctatccgcttgagttcggcacgatctcggtttcggacggcatctccatg
ggtcatgaggggatgcacttctcgctggtttcccgtgaggtgatcgccgacagcgtcgaa
gtcgtgatgcaggccgagcgactcgacggttcggtgctgctggccggatgcgacaaatcg
ctgcctggaatgctgatggccgccgcacgactggatctggcggcggtgttcctctacgcg
ggctctattttgcccggccgggccaagctctccgacggtagcgaacgcgacgtcaccatc
attgacgccttcgaggcggtcggagcgtgctctcgcggtttgatgagtcgcgccgacgtc
gatgccatcgagcgggcaatctgccccggcgaaggggcatgcggcggcatgtacaccgct
aacaccatggccagcgccgccgaggcgctcggcatgtcgttgccgggcagcgcggcaccg
ccggcgaccgaccgccggcgcgacgggttcgcgcgtcgcagcggtcaggccgtcgtcgag
ctgctgcgccgcggcatcaccgcccgcgacatcctcaccaaggaggcgttcgagaacgcc
attgcggtggtaatggcgttcggcggctcgaccaacgcggtgctgcatctgctggccatc
gcccacgaggccaacgtcgcactatcgcttcaggacttcagccggatcgggtcgggggtg
ccgcatttggccgatgtcaagccgttcggccgccatgtgatgtccgacgtcgatcacatc
ggcggtgtgccggtggttatgaaggcgctgctggacgccggtctgctacacggcgactgc
ctgacggttaccggtcacaccatggccgagaatctagctgccatcaccccgccggatcca
gatggcaaggtgctacgtgcgttggcaaacccgatccacccgagcggtggtatcaccatc
ctgcacggatcgctggcacccgaaggtgcggtggtcaagaccgccggattcgattccgac
gtattcgaaggcaccgcaagagttttcgacggcgagcgcgctgcgctggacgcccttgag
gatggcaccattaccgtgggcgacgccgtggtaatccggtacgaaggacccaagggcggc
cccgggatgcgcgaaatgctcgccatcacaggcgcgatcaaaggcgcaggactcggtaaa
gatgttctactgctgaccgacggccggttctccggtggaaccaccggcctgtgcgttggc
cacatcgcaccggaggcggtcgacggcggaccgatcgcacttctgcgcaacggcgaccgg
atccggctcgacgtggccggccgcgttctcgatgtgttggccgatccggccgaattcgtg
tcccgacaacaggatttcagtcctccaccgccgcgctacactactggcgtactggccaag
tacgtcaagctggtcagctctgccgcggtcggcgcggtctgcggctag

DBGET integrated database retrieval system