KEGG   Mycobacterium canettii CIPT 140060008: BN44_10227Help
Entry
BN44_10227        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCK50112
Position
232324..232443
Genome map
AA seq 39 aa AA seqDB search
MSFLVIEVTGIFGAGDAHARMDAAHEFMRLFGFCPKGKT
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctttctggttatcgaagtgaccggaatattcggcgccggcgacgcacacgcgaga
atggatgccgcgcacgagtttatgcgcttgttcgggttctgcccgaaagggaagacttga

DBGET integrated database retrieval system