KEGG   Mycobacterium canettii CIPT 140060008: BN44_10230Help
Entry
BN44_10230        CDS       T02419                                 

Definition
(GenBank) Putative transcriptional regulatory protein
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_13
Motif
Other DBs
NCBI-ProteinID: CCK50115
Position
237272..237856
Genome map
AA seq 194 aa AA seqDB search
MQGPRERMVVSAALLIRERGAHATAISDVLQHSGAPRGSAYHYFPGGRTQLLCEAVDYAG
EHVAAMINEAEGGLELLDALIDKYRQQLLSTDFRAGCPIAAVSVEAGDEQDRERMAPVIA
RAAAVFDRWSDLTAQRFIADGIPPDRAHELAVLATSTLEGAILLARVRRDPTPLDLVHRQ
LRNLLLAELPERSR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtccacgcgaacggatggtggtctcggccgcgctgttgattcgggaacgggga
gcccacgccaccgccatctcggatgtgctgcagcacagcggcgcaccgcgggggtcggcc
tatcactacttcccgggcggtcgtacccaactgctatgcgaggccgtcgattacgccgga
gagcatgtcgccgccatgatcaacgaggccgaagggggcctggagctgctggacgcgctg
attgacaagtatcgccagcagctgctcagcaccgactttcgcgccggctgcccgatcgcc
gcggtctcggtggaggcgggcgacgaacaagatcgcgagcggatggccccggtgatcgcg
cgtgcagcggcggtgtttgaccgctggtcggacttgactgcccagcggttcattgccgac
ggcataccgccggatcgggcgcacgagctggcggtgttggccacgtcgacgctcgagggc
gcaatcttgctggctcgggtgcggcgcgacccgacgccgctggatctggttcaccgccag
ctgcgcaacctgctgctggccgagctgcccgaaaggagccgatga

DBGET integrated database retrieval system