KEGG   Mycobacterium canettii CIPT 140060008: BN44_10245Help
Entry
BN44_10245        CDS       T02419                                 

Definition
(GenBank) Conserved membrane protein of unknown function
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
mcq  Mycobacterium canettii CIPT 140060008
Pathway
mcq00010  Glycolysis / Gluconeogenesis
mcq00020  Citrate cycle (TCA cycle)
mcq00620  Pyruvate metabolism
mcq01100  Metabolic pathways
mcq01110  Biosynthesis of secondary metabolites
mcq01120  Microbial metabolism in diverse environments
mcq01130  Biosynthesis of antibiotics
Module
mcq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN44_10245
   00020 Citrate cycle (TCA cycle)
    BN44_10245
   00620 Pyruvate metabolism
    BN44_10245
Enzymes [BR:mcq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     BN44_10245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_C PEPCK_N
Motif
Other DBs
NCBI-ProteinID: CCK50130
Position
257409..259229
Genome map
AA seq 606 aa AA seqDB search
MTSATIPGLDTAPTNHQGLLSWVEEVAELTQPDRVVFTDGSEEEFQRLCDQLVEAGTFIR
LNPEKHKNSYLALSDPSDVARVESRTYICSAKEIDAGPTNNWMDPGEMRSIMKDLYRGCM
RGRTMYVVPFCMGPLGAEDPKLGVEITDSEYVVVSMRTMTRMGKAALEKMGDDGFFVKAL
HSVGAPLESGQKDVAWPCSETKYITHFPETREIWSYGSGYGGNALLGKKCYSLRIASAMA
HDEGWLAEHMLILKLISPENKAYYFAAAFPSACGKTNLAMLQPTIPGWRAETLGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIAAGNTVFTNVALTDDGDVWWEGLE
GDPQHLIDWKGNDWYFRETETNAAHPNSRYCTPMSQCPILAPEWDDPQGVPISGILFGGR
RKTTVPLVTEARDWQHGVFIGATLGSEQTAAAEGKVGNVRRDPMAMLPFLGYNVGDYFQH
WINLGKHADESKLPKVFFVNWFRRGDDGRFLWPGFGENSRVLKWIVDRIEHKAGGATTPI
GTVPAVEDLDLDGLDVDAADVAAALAVDADEWRQELPLIEEWLQFVGEKLPTGVKDEFDA
LKERLG
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagcgaccatccccggtctggataccgcgccgacgaatcaccaggggttgctg
tcctgggtcgaagaggtcgccgagctcacccagccggaccgggtggtcttcactgacggc
tcggaagaagagttccagcggctctgcgatcagctagtcgaggccggcacgttcatcagg
ctcaaccccgagaagcacaagaactcctacctggcattgtcggatccgtccgatgtcgcg
cgggtggagtcgcggacgtacatctgctcggcgaaagagatcgacgccggccccaccaac
aactggatggatcccggcgaaatgcggtccatcatgaaagacctgtaccggggttgcatg
cgcgggcgcaccatgtatgtggtgccgttctgtatgggaccgctgggcgccgaggacccc
aaacttggtgtggagatcaccgactccgagtacgtcgtcgtctccatgcgcaccatgacc
cggatgggcaaggccgcgctggagaaaatgggcgacgacggtttctttgtcaaggcgctg
cactcggtcggcgcgccgctggaatcgggccaaaaggacgtggcctggccctgcagcgaa
accaagtacatcacccacttcccggagacccgggagatctggagctacggctcgggctac
ggcggcaacgcgttgctgggcaagaagtgctactcactgcgtatcgcgtcggcgatggcc
cacgatgagggctggctggccgagcacatgctgatcctcaagctgatttcgccggagaac
aaggcttactacttcgcggccgcattcccgtcggcgtgtggcaagaccaacctggcgatg
ctgcagccaaccatccccggctggcgtgcggagacactcggagacgacatcgcatggatg
cgatttggcaaggacggtcgcctgtacgccgtcaacccggaattcggcttcttcggggtg
gcgccgggcaccaactggaagtcgaaccctaacgccatgcgcaccattgccgccggcaac
acggtgttcaccaatgtcgcactcaccgacgacggcgacgtgtggtgggagggcctggaa
ggcgacccgcagcacctgatcgactggaagggcaacgactggtacttccgcgagacggaa
accaatgcggcacacccgaactcccggtactgcacaccgatgtcgcagtgcccgatcctg
gcccccgagtgggatgacccgcagggcgtcccgatctcggggatcctgttcggcggccgc
cgcaagaccacggttccgctggtcaccgaggcgcgcgactggcagcacggggtgttcatc
ggtgcgaccctgggtagcgagcagaccgccgcggccgagggcaaggtcggcaatgtgcgc
cgcgacccgatggccatgctgccgtttttgggctacaacgttggggactacttccagcac
tggatcaacctgggcaagcacgccgatgagtccaagctgcccaaggtgttcttcgtcaac
tggttccgtcgcggtgacgacggtcgcttcctgtggccgggcttcggcgagaacagccgg
gtgctgaagtggatcgtcgatcgcatcgagcacaaggccggcggtgcgaccaccccgatc
ggcaccgttcccgccgtggaggacttggacctggacggactggacgtcgacgccgccgat
gtagccgcggcgctggcagtcgatgccgatgaatggcgtcaggaactgccgctgatcgaa
gaatggctgcagttcgtcggcgagaagctgccgaccggtgtcaaagatgagttcgacgcc
ctgaaggagcgcctaggttag

DBGET integrated database retrieval system