KEGG   Mycobacterium canettii CIPT 140060008: BN44_10264Help
Entry
BN44_10264        CDS       T02419                                 

Definition
(GenBank) Conserved protein of unknown function
Organism
mcq  Mycobacterium canettii CIPT 140060008
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VapB_antitoxin
Motif
Other DBs
NCBI-ProteinID: CCK50149
Position
complement(280366..280560)
Genome map
AA seq 64 aa AA seqDB search
MAKHLVDIDEQALNMARTELGTTTIKDTVNAALRQATSQRVQRVAAALDTLAAAPPEDRA
EAWR
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaacatctcgtcgacatcgacgagcaggctttaaacatggctcgtacagaattg
ggcacgacgacgatcaaagacaccgtcaacgcggccctgcggcaagccacgtctcagcga
gttcaacgcgtcgccgccgctctcgacacgctggccgccgcaccgccagaggaccgcgcc
gaagcatggcgctga

DBGET integrated database retrieval system